BLASTX nr result
ID: Cnidium21_contig00008454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00008454 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597250.1| Ribonuclease [Medicago truncatula] gi|355486... 150 1e-34 ref|XP_002529947.1| double-stranded RNA binding protein, putativ... 149 2e-34 ref|XP_003540172.1| PREDICTED: double-stranded RNA-binding prote... 148 5e-34 ref|XP_003538171.1| PREDICTED: double-stranded RNA-binding prote... 148 5e-34 ref|NP_001241242.1| uncharacterized protein LOC100812728 [Glycin... 148 5e-34 >ref|XP_003597250.1| Ribonuclease [Medicago truncatula] gi|355486298|gb|AES67501.1| Ribonuclease [Medicago truncatula] Length = 408 Score = 150 bits (378), Expect = 1e-34 Identities = 73/82 (89%), Positives = 78/82 (95%) Frame = -1 Query: 248 FDSPHYCSTLRQAEHAAAEVALNSLSTRGPSQSLAARILDETGVYKNLLQEIAQRVGAPL 69 F+SPHYCSTLRQAEH+AAEVALNSLS RGPS SLAA+ILDETGVYKNLLQEIAQRVGAPL Sbjct: 44 FESPHYCSTLRQAEHSAAEVALNSLSHRGPSHSLAAKILDETGVYKNLLQEIAQRVGAPL 103 Query: 68 PQYRTFRSGMGHQPVFTGIVEL 3 PQY T+RSG+GH PVFTGIVEL Sbjct: 104 PQYTTYRSGLGHLPVFTGIVEL 125 >ref|XP_002529947.1| double-stranded RNA binding protein, putative [Ricinus communis] gi|223530577|gb|EEF32455.1| double-stranded RNA binding protein, putative [Ricinus communis] Length = 464 Score = 149 bits (377), Expect = 2e-34 Identities = 73/82 (89%), Positives = 76/82 (92%) Frame = -1 Query: 248 FDSPHYCSTLRQAEHAAAEVALNSLSTRGPSQSLAARILDETGVYKNLLQEIAQRVGAPL 69 F+ PHYCSTLRQAEH+AAEVAL SLS RGPS SLAARILDETGVYKNLLQEIAQRVGAPL Sbjct: 44 FECPHYCSTLRQAEHSAAEVALTSLSNRGPSHSLAARILDETGVYKNLLQEIAQRVGAPL 103 Query: 68 PQYRTFRSGMGHQPVFTGIVEL 3 PQY TFRSG+GHQPVFTG VEL Sbjct: 104 PQYTTFRSGLGHQPVFTGTVEL 125 >ref|XP_003540172.1| PREDICTED: double-stranded RNA-binding protein 2-like [Glycine max] Length = 411 Score = 148 bits (373), Expect = 5e-34 Identities = 72/82 (87%), Positives = 77/82 (93%) Frame = -1 Query: 248 FDSPHYCSTLRQAEHAAAEVALNSLSTRGPSQSLAARILDETGVYKNLLQEIAQRVGAPL 69 F+SPHYCSTLRQAEH+AAEVALNSLS RGPS SLAA+ILDETGVYKNLLQEIAQRVGAPL Sbjct: 44 FESPHYCSTLRQAEHSAAEVALNSLSHRGPSHSLAAKILDETGVYKNLLQEIAQRVGAPL 103 Query: 68 PQYRTFRSGMGHQPVFTGIVEL 3 P Y T+RSG+GH PVFTGIVEL Sbjct: 104 PHYTTYRSGLGHLPVFTGIVEL 125 >ref|XP_003538171.1| PREDICTED: double-stranded RNA-binding protein 2-like [Glycine max] Length = 411 Score = 148 bits (373), Expect = 5e-34 Identities = 73/82 (89%), Positives = 76/82 (92%) Frame = -1 Query: 248 FDSPHYCSTLRQAEHAAAEVALNSLSTRGPSQSLAARILDETGVYKNLLQEIAQRVGAPL 69 F+SPHYCSTLRQAEH+AAEVALNSLS R PS SLAARILDETGVYKNLLQEIAQRVGAPL Sbjct: 44 FESPHYCSTLRQAEHSAAEVALNSLSNRAPSHSLAARILDETGVYKNLLQEIAQRVGAPL 103 Query: 68 PQYRTFRSGMGHQPVFTGIVEL 3 PQY TFRSG+GH PVFTG VEL Sbjct: 104 PQYFTFRSGLGHLPVFTGTVEL 125 >ref|NP_001241242.1| uncharacterized protein LOC100812728 [Glycine max] gi|255644888|gb|ACU22944.1| unknown [Glycine max] Length = 401 Score = 148 bits (373), Expect = 5e-34 Identities = 73/82 (89%), Positives = 76/82 (92%) Frame = -1 Query: 248 FDSPHYCSTLRQAEHAAAEVALNSLSTRGPSQSLAARILDETGVYKNLLQEIAQRVGAPL 69 F+SPHYCSTLRQAEH+AAEVALNSLS R PS SLAARILDETGVYKNLLQEIAQRVGAPL Sbjct: 44 FESPHYCSTLRQAEHSAAEVALNSLSNRAPSHSLAARILDETGVYKNLLQEIAQRVGAPL 103 Query: 68 PQYRTFRSGMGHQPVFTGIVEL 3 PQY TFRSG+GH PVFTG VEL Sbjct: 104 PQYFTFRSGLGHLPVFTGTVEL 125