BLASTX nr result
ID: Cnidium21_contig00008408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00008408 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK43404.1| unknown [Lotus japonicus] 71 8e-11 gb|ACI22358.1| 5'-methylthioadenosine nucleosidase [Lupinus lute... 70 1e-10 gb|AGE46019.1| 5'-methylthioadenosine/s-adenosylhomocysteine nuc... 69 3e-10 ref|XP_002529258.1| mta/sah nucleosidase, putative [Ricinus comm... 69 4e-10 ref|XP_002313743.1| predicted protein [Populus trichocarpa] gi|2... 69 4e-10 >gb|AFK43404.1| unknown [Lotus japonicus] Length = 259 Score = 71.2 bits (173), Expect = 8e-11 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 135 SRFPKGVPWVRYHGTYKDLNVNIMWPGKDAVLGVD 239 S FP+GVPWVRYHGTYKDLN+N++WPGKD LGVD Sbjct: 46 SPFPQGVPWVRYHGTYKDLNINLIWPGKDPTLGVD 80 >gb|ACI22358.1| 5'-methylthioadenosine nucleosidase [Lupinus luteus] gi|216360974|gb|ACJ72491.1| 5'-methylthioadenosine nucleosidase [Lupinus luteus] Length = 253 Score = 70.5 bits (171), Expect = 1e-10 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 135 SRFPKGVPWVRYHGTYKDLNVNIMWPGKDAVLGVD 239 S FP+GVPWVRYHGTYKDLN+N++WPGKD LGVD Sbjct: 40 SPFPEGVPWVRYHGTYKDLNLNLIWPGKDPALGVD 74 >gb|AGE46019.1| 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase 1-like protein [Elaeis guineensis] Length = 283 Score = 69.3 bits (168), Expect = 3e-10 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +3 Query: 135 SRFPKGVPWVRYHGTYKDLNVNIMWPGKDAVLGVD 239 S FPKGVPWVRYHG YK+L++N++WPGKD+VLGVD Sbjct: 70 SLFPKGVPWVRYHGKYKELDINLVWPGKDSVLGVD 104 >ref|XP_002529258.1| mta/sah nucleosidase, putative [Ricinus communis] gi|223531294|gb|EEF33136.1| mta/sah nucleosidase, putative [Ricinus communis] Length = 266 Score = 68.9 bits (167), Expect = 4e-10 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 135 SRFPKGVPWVRYHGTYKDLNVNIMWPGKDAVLGVD 239 S FP+GVPWVRYHG YKDL++NI+WPGKD+ LGVD Sbjct: 53 SAFPEGVPWVRYHGIYKDLHINIVWPGKDSTLGVD 87 >ref|XP_002313743.1| predicted protein [Populus trichocarpa] gi|222850151|gb|EEE87698.1| predicted protein [Populus trichocarpa] Length = 263 Score = 68.9 bits (167), Expect = 4e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 135 SRFPKGVPWVRYHGTYKDLNVNIMWPGKDAVLGVD 239 S FPKGVPWVRYHG YKDL +N++WPGKD+ LGVD Sbjct: 50 SVFPKGVPWVRYHGVYKDLQINLVWPGKDSTLGVD 84