BLASTX nr result
ID: Cnidium21_contig00008320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00008320 (2444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513582.1| polypyrimidine tract binding protein, putati... 85 8e-14 ref|XP_002533645.1| ATATH9, putative [Ricinus communis] gi|22352... 69 1e-13 ref|NP_001078750.1| polypyrimidine tract-binding protein 2 [Arab... 84 1e-13 ref|XP_002317750.1| predicted protein [Populus trichocarpa] gi|2... 83 3e-13 gb|ABK95840.1| unknown [Populus trichocarpa] 83 3e-13 >ref|XP_002513582.1| polypyrimidine tract binding protein, putative [Ricinus communis] gi|223547490|gb|EEF48985.1| polypyrimidine tract binding protein, putative [Ricinus communis] Length = 447 Score = 85.1 bits (209), Expect = 8e-14 Identities = 52/104 (50%), Positives = 62/104 (59%), Gaps = 1/104 (0%) Frame = -3 Query: 675 FGFEHHGPTH*NHLIGCQQVMMIKDRYTARALLLATIYVYENSLVLLLFFHSRTSVNYLI 496 FGF H T G Q ++ D TA + +N+L R YL+ Sbjct: 137 FGFVHKITTF-EKTAGFQALVQFSDAETASSA--------KNAL------DGRNIPRYLL 181 Query: 495 PE-LSPCSLKITYSAHTDLSVKFQSHRSRDYTNPSLPVNPSAID 367 PE + PC+L+ITYSAHTDLSVKFQSHRSRDYTNP+LPV PSAID Sbjct: 182 PEHIGPCTLRITYSAHTDLSVKFQSHRSRDYTNPNLPVAPSAID 225 >ref|XP_002533645.1| ATATH9, putative [Ricinus communis] gi|223526458|gb|EEF28733.1| ATATH9, putative [Ricinus communis] Length = 549 Score = 68.9 bits (167), Expect(2) = 1e-13 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 1864 DNQELDFLVEAKNSVKCMDNFRKLSPHIADYVYAPGI 1754 D+QELDFLVEAKNS KC+ NFRKLSPHIADYVYAP + Sbjct: 240 DHQELDFLVEAKNSEKCLHNFRKLSPHIADYVYAPKV 276 Score = 35.8 bits (81), Expect(2) = 1e-13 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -1 Query: 1757 NLSISKLVTMEYIEGAQINDLK 1692 NLS SKL+TME+I+ AQ+ND+K Sbjct: 279 NLSTSKLLTMEFIDAAQVNDVK 300 >ref|NP_001078750.1| polypyrimidine tract-binding protein 2 [Arabidopsis thaliana] gi|110737620|dbj|BAF00751.1| polypyrimidine tract-binding RNA transport protein-like [Arabidopsis thaliana] gi|332008936|gb|AED96319.1| polypyrimidine tract-binding protein 2 [Arabidopsis thaliana] Length = 329 Score = 84.3 bits (207), Expect = 1e-13 Identities = 55/120 (45%), Positives = 64/120 (53%), Gaps = 1/120 (0%) Frame = -3 Query: 699 DRDRSLKGFGFEHHGPTH*NHLIGCQQVMMIKDRYTARALLLATIYVYENSLVLLLFFHS 520 +R FGF H T G Q ++ D TA A LA Sbjct: 29 ERAHVFSAFGFVHKITTF-EKTAGYQALVQFTDAETATAAKLA--------------LDG 73 Query: 519 RTSVNYLIPE-LSPCSLKITYSAHTDLSVKFQSHRSRDYTNPSLPVNPSAIDVTP*MLLG 343 R+ YL+ E + CSLKITYSAHTDL+VKFQSHRSRDYTNP LPV PSAID T + +G Sbjct: 74 RSIPRYLLAETVGQCSLKITYSAHTDLTVKFQSHRSRDYTNPYLPVAPSAIDSTGQVAVG 133 >ref|XP_002317750.1| predicted protein [Populus trichocarpa] gi|222858423|gb|EEE95970.1| predicted protein [Populus trichocarpa] Length = 350 Score = 83.2 bits (204), Expect = 3e-13 Identities = 52/104 (50%), Positives = 62/104 (59%), Gaps = 1/104 (0%) Frame = -3 Query: 675 FGFEHHGPTH*NHLIGCQQVMMIKDRYTARALLLATIYVYENSLVLLLFFHSRTSVNYLI 496 FGF H T G Q ++ D TA + +N+L R +YL+ Sbjct: 128 FGFVHKITTF-EKTAGFQALVQFSDAETASSA--------KNAL------DGRNIPSYLL 172 Query: 495 PE-LSPCSLKITYSAHTDLSVKFQSHRSRDYTNPSLPVNPSAID 367 PE L PC+L+ITYSAHTDLSVKFQSHRSRDYTN +LPV PSAID Sbjct: 173 PEHLGPCTLRITYSAHTDLSVKFQSHRSRDYTNANLPVAPSAID 216 >gb|ABK95840.1| unknown [Populus trichocarpa] Length = 442 Score = 83.2 bits (204), Expect = 3e-13 Identities = 52/104 (50%), Positives = 62/104 (59%), Gaps = 1/104 (0%) Frame = -3 Query: 675 FGFEHHGPTH*NHLIGCQQVMMIKDRYTARALLLATIYVYENSLVLLLFFHSRTSVNYLI 496 FGF H T G Q ++ D TA + +N+L R +YL+ Sbjct: 137 FGFVHKITTF-EKTAGFQALVQFSDAETASSA--------KNAL------DGRNIPSYLL 181 Query: 495 PE-LSPCSLKITYSAHTDLSVKFQSHRSRDYTNPSLPVNPSAID 367 PE L PC+L+ITYSAHTDLSVKFQSHRSRDYTN +LPV PSAID Sbjct: 182 PEHLGPCTLRITYSAHTDLSVKFQSHRSRDYTNANLPVAPSAID 225