BLASTX nr result
ID: Cnidium21_contig00008158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00008158 (635 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004164469.1| PREDICTED: uncharacterized membrane protein ... 60 4e-07 ref|XP_004148435.1| PREDICTED: uncharacterized membrane protein ... 60 4e-07 ref|XP_003611898.1| Membrane protein, putative [Medicago truncat... 59 7e-07 ref|XP_003611897.1| Membrane protein, putative [Medicago truncat... 59 7e-07 ref|XP_003611896.1| Membrane protein, putative [Medicago truncat... 59 7e-07 >ref|XP_004164469.1| PREDICTED: uncharacterized membrane protein YOL092W-like [Cucumis sativus] Length = 381 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/45 (66%), Positives = 34/45 (75%), Gaps = 2/45 (4%) Frame = -3 Query: 633 PWLLDAVVCVGLDLFIILQYIYYRYFGNRTTSGRGSND--DYSES 505 PWLLDAVVCV LDLFIILQYIYYR F + SG G ++ DY E+ Sbjct: 331 PWLLDAVVCVLLDLFIILQYIYYRRFRRQRQSGGGRDEFKDYEEA 375 >ref|XP_004148435.1| PREDICTED: uncharacterized membrane protein YOL092W-like [Cucumis sativus] Length = 381 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/45 (66%), Positives = 34/45 (75%), Gaps = 2/45 (4%) Frame = -3 Query: 633 PWLLDAVVCVGLDLFIILQYIYYRYFGNRTTSGRGSND--DYSES 505 PWLLDAVVCV LDLFIILQYIYYR F + SG G ++ DY E+ Sbjct: 331 PWLLDAVVCVLLDLFIILQYIYYRRFRRQRQSGGGRDEFKDYEEA 375 >ref|XP_003611898.1| Membrane protein, putative [Medicago truncatula] gi|355513233|gb|AES94856.1| Membrane protein, putative [Medicago truncatula] Length = 196 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/44 (65%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 633 PWLLDAVVCVGLDLFIILQYIYYRYFGNRTTSG-RGSNDDYSES 505 PWLLDA+VCV LDLFIILQYI YRY TTS G+ DY E+ Sbjct: 147 PWLLDAIVCVALDLFIILQYINYRYHRKTTTSSDYGNYQDYKEA 190 >ref|XP_003611897.1| Membrane protein, putative [Medicago truncatula] gi|355513232|gb|AES94855.1| Membrane protein, putative [Medicago truncatula] Length = 380 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/44 (65%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 633 PWLLDAVVCVGLDLFIILQYIYYRYFGNRTTSG-RGSNDDYSES 505 PWLLDA+VCV LDLFIILQYI YRY TTS G+ DY E+ Sbjct: 331 PWLLDAIVCVALDLFIILQYINYRYHRKTTTSSDYGNYQDYKEA 374 >ref|XP_003611896.1| Membrane protein, putative [Medicago truncatula] gi|355513231|gb|AES94854.1| Membrane protein, putative [Medicago truncatula] Length = 382 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/44 (65%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 633 PWLLDAVVCVGLDLFIILQYIYYRYFGNRTTSG-RGSNDDYSES 505 PWLLDA+VCV LDLFIILQYI YRY TTS G+ DY E+ Sbjct: 333 PWLLDAIVCVALDLFIILQYINYRYHRKTTTSSDYGNYQDYKEA 376