BLASTX nr result
ID: Cnidium21_contig00007743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00007743 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512111.1| CLE9, putative [Ricinus communis] gi|2235492... 62 6e-08 ref|XP_002893393.1| hypothetical protein ARALYDRAFT_472749 [Arab... 59 4e-07 gb|AAF98585.1|AC013427_28 EST gb|U74112 comes from this gene [Ar... 59 5e-07 ref|NP_564251.1| protein CLAVATA3/ESR-related 9 [Arabidopsis tha... 59 5e-07 gb|AAM64423.1| CLE gene family, putative [Arabidopsis thaliana] 56 3e-06 >ref|XP_002512111.1| CLE9, putative [Ricinus communis] gi|223549291|gb|EEF50780.1| CLE9, putative [Ricinus communis] Length = 117 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/60 (51%), Positives = 38/60 (63%) Frame = -2 Query: 203 SCTSFSKISSETPPPVFCFQYPKKSHMDSPARSQGGADEIDPRYGVEKRLVPSGPNPLHN 24 SC SF +S + F P++ + P S G D+IDPRYGV+KRLVPSGPNPLHN Sbjct: 58 SCASFPHKTSRSLCIQFQRMNPQRRFIAPPPPSPPGDDQIDPRYGVDKRLVPSGPNPLHN 117 >ref|XP_002893393.1| hypothetical protein ARALYDRAFT_472749 [Arabidopsis lyrata subsp. lyrata] gi|297339235|gb|EFH69652.1| hypothetical protein ARALYDRAFT_472749 [Arabidopsis lyrata subsp. lyrata] Length = 120 Score = 58.9 bits (141), Expect = 4e-07 Identities = 35/72 (48%), Positives = 43/72 (59%), Gaps = 3/72 (4%) Frame = -2 Query: 230 HRRYHVL-HRSCTSFSKISSETPPPVFCFQYPK--KSHMDSPARSQGGADEIDPRYGVEK 60 H YHV HRSC SF++ + + C + + +S P S EIDPRYGV+K Sbjct: 54 HHPYHVTPHRSCDSFTRPYARS----MCIELQRIHRSSRKLPLLSPP-PPEIDPRYGVDK 108 Query: 59 RLVPSGPNPLHN 24 RLVPSGPNPLHN Sbjct: 109 RLVPSGPNPLHN 120 >gb|AAF98585.1|AC013427_28 EST gb|U74112 comes from this gene [Arabidopsis thaliana] Length = 118 Score = 58.5 bits (140), Expect = 5e-07 Identities = 35/72 (48%), Positives = 42/72 (58%), Gaps = 3/72 (4%) Frame = -2 Query: 230 HRRYHVL-HRSCTSFSKISSETPPPVFCFQYPK--KSHMDSPARSQGGADEIDPRYGVEK 60 H YHV HRSC SF + + + C + + +S P S EIDPRYGV+K Sbjct: 52 HHPYHVTPHRSCDSFIRPYARS----MCIELQRIHRSSRKQPLLSPP-PPEIDPRYGVDK 106 Query: 59 RLVPSGPNPLHN 24 RLVPSGPNPLHN Sbjct: 107 RLVPSGPNPLHN 118 >ref|NP_564251.1| protein CLAVATA3/ESR-related 9 [Arabidopsis thaliana] gi|313471278|sp|Q9FZE4.2|CLE9_ARATH RecName: Full=CLAVATA3/ESR (CLE)-related protein 9; Contains: RecName: Full=CLE9p; Flags: Precursor gi|332192587|gb|AEE30708.1| protein CLAVATA3/ESR-related 9 [Arabidopsis thaliana] Length = 120 Score = 58.5 bits (140), Expect = 5e-07 Identities = 35/72 (48%), Positives = 42/72 (58%), Gaps = 3/72 (4%) Frame = -2 Query: 230 HRRYHVL-HRSCTSFSKISSETPPPVFCFQYPK--KSHMDSPARSQGGADEIDPRYGVEK 60 H YHV HRSC SF + + + C + + +S P S EIDPRYGV+K Sbjct: 54 HHPYHVTPHRSCDSFIRPYARS----MCIELQRIHRSSRKQPLLSPP-PPEIDPRYGVDK 108 Query: 59 RLVPSGPNPLHN 24 RLVPSGPNPLHN Sbjct: 109 RLVPSGPNPLHN 120 >gb|AAM64423.1| CLE gene family, putative [Arabidopsis thaliana] Length = 120 Score = 56.2 bits (134), Expect = 3e-06 Identities = 34/72 (47%), Positives = 41/72 (56%), Gaps = 3/72 (4%) Frame = -2 Query: 230 HRRYHVL-HRSCTSFSKISSETPPPVFCFQYPK--KSHMDSPARSQGGADEIDPRYGVEK 60 H YHV HRSC SF + + + C + + +S P EIDPRYGV+K Sbjct: 54 HHPYHVTPHRSCDSFIRPYARS----MCIELQRIHRSSRKQPLLFPP-PPEIDPRYGVDK 108 Query: 59 RLVPSGPNPLHN 24 RLVPSGPNPLHN Sbjct: 109 RLVPSGPNPLHN 120