BLASTX nr result
ID: Cnidium21_contig00007651
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00007651 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABE66400.1| carbonic anhydrase [Striga asiatica] 65 6e-09 ref|XP_002277957.1| PREDICTED: carbonic anhydrase, chloroplastic... 62 6e-08 emb|CAN61667.1| hypothetical protein VITISV_037833 [Vitis vinifera] 62 6e-08 emb|CAH60890.1| carbonic anhydrase [Solanum lycopersicum] 61 1e-07 gb|AAA34057.1| carbonic anhydrase, partial [Nicotiana tabacum] 60 1e-07 >gb|ABE66400.1| carbonic anhydrase [Striga asiatica] Length = 159 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 FVREAVAKNALTLKGGHYDFVQGSFELWSLDLGLTPSIII 122 FVREAV K L+LKGGHYDFV+GSFELW+LD L+PS+ + Sbjct: 120 FVREAVVKKTLSLKGGHYDFVKGSFELWNLDFNLSPSMTV 159 >ref|XP_002277957.1| PREDICTED: carbonic anhydrase, chloroplastic [Vitis vinifera] gi|296087661|emb|CBI34917.3| unnamed protein product [Vitis vinifera] Length = 335 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 3 FVREAVAKNALTLKGGHYDFVQGSFELWSLDLGLTPSIII 122 FVRE + K LTLKGG+YDFV+G+FELW LD GL+PS + Sbjct: 285 FVREGLVKKTLTLKGGYYDFVKGTFELWGLDFGLSPSFSV 324 >emb|CAN61667.1| hypothetical protein VITISV_037833 [Vitis vinifera] Length = 331 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 3 FVREAVAKNALTLKGGHYDFVQGSFELWSLDLGLTPSIII 122 FVRE + K LTLKGG+YDFV+G+FELW LD GL+PS + Sbjct: 292 FVREGLVKKTLTLKGGYYDFVKGTFELWGLDFGLSPSFSV 331 >emb|CAH60890.1| carbonic anhydrase [Solanum lycopersicum] Length = 268 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 3 FVREAVAKNALTLKGGHYDFVQGSFELWSLDLGLTPSIII 122 FVREAV K + LKGGHYDF GSFELW++D LTPS+ + Sbjct: 229 FVREAVVKKNIALKGGHYDFENGSFELWNIDFKLTPSVAL 268 >gb|AAA34057.1| carbonic anhydrase, partial [Nicotiana tabacum] Length = 264 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 3 FVREAVAKNALTLKGGHYDFVQGSFELWSLDLGLTPSIII 122 FVRE + K L LKGGHYDFV G FELW L+ GL+PS+ + Sbjct: 225 FVREGLVKKTLALKGGHYDFVNGGFELWGLEFGLSPSLSV 264