BLASTX nr result
ID: Cnidium21_contig00007571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00007571 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631639.1| PREDICTED: BURP domain-containing protein 17... 57 2e-06 emb|CAN74522.1| hypothetical protein VITISV_034298 [Vitis vinifera] 57 2e-06 ref|XP_002509472.1| Dehydration-responsive protein RD22 precurso... 54 1e-05 ref|XP_002313054.1| predicted protein [Populus trichocarpa] gi|2... 54 1e-05 gb|ABK96114.1| unknown [Populus trichocarpa] 54 1e-05 >ref|XP_003631639.1| PREDICTED: BURP domain-containing protein 17-like isoform 1 [Vitis vinifera] gi|359475294|ref|XP_003631640.1| PREDICTED: BURP domain-containing protein 17-like isoform 2 [Vitis vinifera] Length = 331 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +2 Query: 218 SEIVFFKMEDLKIGKTMPIFFPRTDPSKSSQLLIKEKADRI 340 S +VFF M+DLK+GKTMPI+F +TDP+ S ++L KE+AD I Sbjct: 106 SVVVFFTMKDLKVGKTMPIYFAKTDPASSPRMLPKEEADSI 146 >emb|CAN74522.1| hypothetical protein VITISV_034298 [Vitis vinifera] Length = 313 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +2 Query: 218 SEIVFFKMEDLKIGKTMPIFFPRTDPSKSSQLLIKEKADRI 340 S +VFF M+DLK+GKTMPI+F +TDP+ S ++L KE+AD I Sbjct: 88 SVVVFFTMKDLKVGKTMPIYFAKTDPASSPRMLPKEEADSI 128 >ref|XP_002509472.1| Dehydration-responsive protein RD22 precursor, putative [Ricinus communis] gi|223549371|gb|EEF50859.1| Dehydration-responsive protein RD22 precursor, putative [Ricinus communis] Length = 295 Score = 54.3 bits (129), Expect = 1e-05 Identities = 37/85 (43%), Positives = 48/85 (56%), Gaps = 6/85 (7%) Frame = +2 Query: 104 GSRALTDDIIKENSNVLQLQSMDEXXXXXXXXXXX------IKDSEIVFFKMEDLKIGKT 265 G+R +T I +NSNVL+L SMD + S IVFF + DLK+GK Sbjct: 25 GAREMT--IPMQNSNVLRLPSMDHQVHAHAHANSKSSHMDHMDPSLIVFFTLNDLKVGKK 82 Query: 266 MPIFFPRTDPSKSSQLLIKEKADRI 340 MPIFFP D S +S LL +++AD I Sbjct: 83 MPIFFPMKD-SSTSTLLPRDEADSI 106 >ref|XP_002313054.1| predicted protein [Populus trichocarpa] gi|222849462|gb|EEE87009.1| predicted protein [Populus trichocarpa] Length = 288 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = +2 Query: 218 SEIVFFKMEDLKIGKTMPIFFPRTDPSKSSQLLIKEKADRI 340 S +VFF + DLK+G+TMPI+FP+ DPSKS +LL +E A+ I Sbjct: 56 SLLVFFTLNDLKVGRTMPIYFPKKDPSKSPRLLPREDANSI 96 >gb|ABK96114.1| unknown [Populus trichocarpa] Length = 288 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = +2 Query: 218 SEIVFFKMEDLKIGKTMPIFFPRTDPSKSSQLLIKEKADRI 340 S +VFF + DLK+G+TMPI+FP+ DPSKS +LL +E A+ I Sbjct: 56 SLLVFFTLNDLKVGRTMPIYFPKKDPSKSPRLLPREDANSI 96