BLASTX nr result
ID: Cnidium21_contig00007303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00007303 (677 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270790.1| PREDICTED: spermine synthase [Vitis vinifera] 88 2e-22 emb|CBI22532.3| unnamed protein product [Vitis vinifera] 88 2e-22 emb|CAN73402.1| hypothetical protein VITISV_020278 [Vitis vinifera] 87 4e-22 ref|XP_002318386.1| predicted protein [Populus trichocarpa] gi|2... 87 6e-22 ref|XP_002513571.1| spermidine synthase 1, putative [Ricinus com... 86 1e-21 >ref|XP_002270790.1| PREDICTED: spermine synthase [Vitis vinifera] Length = 369 Score = 88.2 bits (217), Expect(2) = 2e-22 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = +2 Query: 179 GPAQELVERPFFQTTARALRPGGVLCSMAESMWLHTHLIEDMI 307 GPAQELVERPFF+TTARALRPGGVLC+MAESMWLHTHLI+DM+ Sbjct: 229 GPAQELVERPFFETTARALRPGGVLCNMAESMWLHTHLIQDML 271 Score = 43.5 bits (101), Expect(2) = 2e-22 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +3 Query: 309 KETFKGSVHYAWTSVPTYP 365 +ETFKGSVHYAW SVPTYP Sbjct: 275 RETFKGSVHYAWASVPTYP 293 >emb|CBI22532.3| unnamed protein product [Vitis vinifera] Length = 355 Score = 88.2 bits (217), Expect(2) = 2e-22 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = +2 Query: 179 GPAQELVERPFFQTTARALRPGGVLCSMAESMWLHTHLIEDMI 307 GPAQELVERPFF+TTARALRPGGVLC+MAESMWLHTHLI+DM+ Sbjct: 215 GPAQELVERPFFETTARALRPGGVLCNMAESMWLHTHLIQDML 257 Score = 43.5 bits (101), Expect(2) = 2e-22 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +3 Query: 309 KETFKGSVHYAWTSVPTYP 365 +ETFKGSVHYAW SVPTYP Sbjct: 261 RETFKGSVHYAWASVPTYP 279 >emb|CAN73402.1| hypothetical protein VITISV_020278 [Vitis vinifera] Length = 369 Score = 87.0 bits (214), Expect(2) = 4e-22 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +2 Query: 179 GPAQELVERPFFQTTARALRPGGVLCSMAESMWLHTHLIEDMI 307 GPAQELVERPFF+TTARALRPGGVLC+MAESMWLHTHLI DM+ Sbjct: 229 GPAQELVERPFFETTARALRPGGVLCNMAESMWLHTHLIXDML 271 Score = 43.5 bits (101), Expect(2) = 4e-22 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +3 Query: 309 KETFKGSVHYAWTSVPTYP 365 +ETFKGSVHYAW SVPTYP Sbjct: 275 RETFKGSVHYAWASVPTYP 293 >ref|XP_002318386.1| predicted protein [Populus trichocarpa] gi|222859059|gb|EEE96606.1| predicted protein [Populus trichocarpa] Length = 347 Score = 86.7 bits (213), Expect(2) = 6e-22 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +2 Query: 179 GPAQELVERPFFQTTARALRPGGVLCSMAESMWLHTHLIEDMI 307 GPAQELVE+PFF+T ARALRPGGVLC+MAESMWLHTHLIEDMI Sbjct: 215 GPAQELVEKPFFETIARALRPGGVLCNMAESMWLHTHLIEDMI 257 Score = 43.5 bits (101), Expect(2) = 6e-22 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +3 Query: 309 KETFKGSVHYAWTSVPTYP 365 +ETFKGSVHYAW SVPTYP Sbjct: 261 RETFKGSVHYAWASVPTYP 279 >ref|XP_002513571.1| spermidine synthase 1, putative [Ricinus communis] gi|223547479|gb|EEF48974.1| spermidine synthase 1, putative [Ricinus communis] Length = 368 Score = 85.5 bits (210), Expect(2) = 1e-21 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 179 GPAQELVERPFFQTTARALRPGGVLCSMAESMWLHTHLIEDMI 307 GPAQELVE+PFFQT A+ALRPGGVLC+MAESMWLHTHLI+DMI Sbjct: 228 GPAQELVEKPFFQTIAKALRPGGVLCNMAESMWLHTHLIQDMI 270 Score = 43.5 bits (101), Expect(2) = 1e-21 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +3 Query: 309 KETFKGSVHYAWTSVPTYP 365 +ETFKGSVHYAW SVPTYP Sbjct: 274 RETFKGSVHYAWASVPTYP 292