BLASTX nr result
ID: Cnidium21_contig00007260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00007260 (1037 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM34765.1|AF509865_1 nam-like protein 2 [Petunia x hybrida] 83 1e-13 ref|NP_201211.1| NAC domain containing protein 103 [Arabidopsis ... 80 8e-13 ref|XP_002866590.1| ANAC103 [Arabidopsis lyrata subsp. lyrata] g... 79 2e-12 gb|ADZ55681.1| NAC transcription factor [Setaria italica] 79 2e-12 ref|XP_002328323.1| NAC domain protein, IPR003441 [Populus trich... 79 2e-12 >gb|AAM34765.1|AF509865_1 nam-like protein 2 [Petunia x hybrida] Length = 487 Score = 82.8 bits (203), Expect = 1e-13 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -2 Query: 730 MGILPPGFRFHPTDVELVMYYLKRKVTGKKFQFEAMAELNVYKYEP*DL 584 MG LPPGFRFHPTDVELVMYYLKRK+ GKK F+A+ ELN+YK P DL Sbjct: 1 MGRLPPGFRFHPTDVELVMYYLKRKIMGKKLHFDAITELNIYKVSPWDL 49 >ref|NP_201211.1| NAC domain containing protein 103 [Arabidopsis thaliana] gi|10176954|dbj|BAB10274.1| unnamed protein product [Arabidopsis thaliana] gi|332010452|gb|AED97835.1| NAC domain containing protein 103 [Arabidopsis thaliana] Length = 356 Score = 80.1 bits (196), Expect = 8e-13 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = -2 Query: 721 LPPGFRFHPTDVELVMYYLKRKVTGKKFQFEAMAELNVYKYEP*DLAD 578 L PGFRFHPTDVELV YYLKRKV GKKFQ +A+AE+++YK+EP DL D Sbjct: 6 LAPGFRFHPTDVELVRYYLKRKVMGKKFQVDAIAEVDIYKFEPPDLPD 53 >ref|XP_002866590.1| ANAC103 [Arabidopsis lyrata subsp. lyrata] gi|297312425|gb|EFH42849.1| ANAC103 [Arabidopsis lyrata subsp. lyrata] Length = 363 Score = 79.0 bits (193), Expect = 2e-12 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = -2 Query: 721 LPPGFRFHPTDVELVMYYLKRKVTGKKFQFEAMAELNVYKYEP*DLAD 578 L PGFRFHPTDVELV YYLKRKV GKKFQ +A+AE+++YK+EP DL + Sbjct: 6 LAPGFRFHPTDVELVRYYLKRKVMGKKFQVDAIAEIDIYKFEPPDLPE 53 >gb|ADZ55681.1| NAC transcription factor [Setaria italica] Length = 461 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/61 (62%), Positives = 42/61 (68%) Frame = -2 Query: 721 LPPGFRFHPTDVELVMYYLKRKVTGKKFQFEAMAELNVYKYEP*DLADVELVMYNFYGKY 542 LPPGFRFHPTDVEL YYLKRK+TGKK EA+AE+ +YKY P DL D V Y Sbjct: 6 LPPGFRFHPTDVELCSYYLKRKITGKKLLVEAIAEVELYKYSPWDLPDKSCVKSRDMEWY 65 Query: 541 F 539 F Sbjct: 66 F 66 >ref|XP_002328323.1| NAC domain protein, IPR003441 [Populus trichocarpa] gi|222838038|gb|EEE76403.1| NAC domain protein, IPR003441 [Populus trichocarpa] Length = 402 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 721 LPPGFRFHPTDVELVMYYLKRKVTGKKFQFEAMAELNVYKYEP*DL 584 LPPGFRFHPTDVELV YYLKRKV GKK F+A+AE+ +YKY P DL Sbjct: 7 LPPGFRFHPTDVELVKYYLKRKVLGKKLHFQAIAEVEIYKYAPWDL 52