BLASTX nr result
ID: Cnidium21_contig00007196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00007196 (736 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309559.1| predicted protein [Populus trichocarpa] gi|2... 70 6e-10 emb|CAN72066.1| hypothetical protein VITISV_042589 [Vitis vinifera] 70 6e-10 ref|XP_003568728.1| PREDICTED: coiled-coil domain-containing pro... 69 1e-09 ref|XP_004168636.1| PREDICTED: coiled-coil domain-containing pro... 68 2e-09 ref|XP_004136294.1| PREDICTED: coiled-coil domain-containing pro... 68 2e-09 >ref|XP_002309559.1| predicted protein [Populus trichocarpa] gi|222855535|gb|EEE93082.1| predicted protein [Populus trichocarpa] Length = 215 Score = 69.7 bits (169), Expect = 6e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 639 MVFYFKARPEVGDYTIFMGLDKHENEELIKYG 734 MVFYFKARPE GDYTIFMGLDKHENEELIKYG Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKHENEELIKYG 32 >emb|CAN72066.1| hypothetical protein VITISV_042589 [Vitis vinifera] Length = 199 Score = 69.7 bits (169), Expect = 6e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 639 MVFYFKARPEVGDYTIFMGLDKHENEELIKYG 734 MVFYFKARPE GDYTIFMGLDKHENEELIKYG Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKHENEELIKYG 32 >ref|XP_003568728.1| PREDICTED: coiled-coil domain-containing protein 25-like [Brachypodium distachyon] Length = 215 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 639 MVFYFKARPEVGDYTIFMGLDKHENEELIKYG 734 MVFYFKARPE GDYTIFMGLDKHENE+LIKYG Sbjct: 1 MVFYFKARPEAGDYTIFMGLDKHENEDLIKYG 32 >ref|XP_004168636.1| PREDICTED: coiled-coil domain-containing protein 25-like [Cucumis sativus] Length = 215 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 639 MVFYFKARPEVGDYTIFMGLDKHENEELIKYG 734 MVFYFKARP+VGDYTIFMGLDK+ENEELIKYG Sbjct: 1 MVFYFKARPDVGDYTIFMGLDKYENEELIKYG 32 >ref|XP_004136294.1| PREDICTED: coiled-coil domain-containing protein 25-like [Cucumis sativus] Length = 215 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 639 MVFYFKARPEVGDYTIFMGLDKHENEELIKYG 734 MVFYFKARP+VGDYTIFMGLDK+ENEELIKYG Sbjct: 1 MVFYFKARPDVGDYTIFMGLDKYENEELIKYG 32