BLASTX nr result
ID: Cnidium21_contig00007142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00007142 (439 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB18171.1| homeobox-leucine zipper protein [Zinnia elegans] 81 8e-14 dbj|BAB18164.1| homeobox-leucine zipper protein [Zinnia elegans] 81 8e-14 emb|CBI33148.3| unnamed protein product [Vitis vinifera] 76 3e-12 ref|XP_003632476.1| PREDICTED: homeobox-leucine zipper protein A... 76 3e-12 emb|CAN62215.1| hypothetical protein VITISV_008512 [Vitis vinifera] 76 3e-12 >dbj|BAB18171.1| homeobox-leucine zipper protein [Zinnia elegans] Length = 247 Score = 81.3 bits (199), Expect = 8e-14 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 1 YQPQFVKIEEHNFLSGDESCDFFSDDQDPSLQWYCHDQW 117 YQPQFVK+EEHNF GDESC+FFSDDQ P+LQWYC DQW Sbjct: 203 YQPQFVKLEEHNFFGGDESCNFFSDDQAPTLQWYCQDQW 241 >dbj|BAB18164.1| homeobox-leucine zipper protein [Zinnia elegans] Length = 151 Score = 81.3 bits (199), Expect = 8e-14 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 1 YQPQFVKIEEHNFLSGDESCDFFSDDQDPSLQWYCHDQW 117 YQPQFVK+EEHNF GDESC+FFSDDQ P+LQWYC DQW Sbjct: 107 YQPQFVKLEEHNFFGGDESCNFFSDDQAPTLQWYCQDQW 145 >emb|CBI33148.3| unnamed protein product [Vitis vinifera] Length = 280 Score = 75.9 bits (185), Expect = 3e-12 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 1 YQPQFVKIEEHNFLSGDESCDFFSDDQDPSLQWYCHDQW 117 YQPQFVK+EEHNF DESC+FFSDDQ P+L WYC DQW Sbjct: 241 YQPQFVKMEEHNFFGADESCNFFSDDQPPTLPWYCPDQW 279 >ref|XP_003632476.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Vitis vinifera] Length = 335 Score = 75.9 bits (185), Expect = 3e-12 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 1 YQPQFVKIEEHNFLSGDESCDFFSDDQDPSLQWYCHDQW 117 YQPQFVK+EEHNF DESC+FFSDDQ P+L WYC DQW Sbjct: 296 YQPQFVKMEEHNFFGADESCNFFSDDQPPTLPWYCPDQW 334 >emb|CAN62215.1| hypothetical protein VITISV_008512 [Vitis vinifera] Length = 345 Score = 75.9 bits (185), Expect = 3e-12 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 1 YQPQFVKIEEHNFLSGDESCDFFSDDQDPSLQWYCHDQW 117 YQPQFVK+EEHNF DESC+FFSDDQ P+L WYC DQW Sbjct: 306 YQPQFVKMEEHNFFGADESCNFFSDDQPPTLPWYCPDQW 344