BLASTX nr result
ID: Cnidium21_contig00006949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00006949 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511294.1| cytochrome P450, putative [Ricinus communis]... 68 9e-10 ref|XP_002276812.2| PREDICTED: cytochrome P450 71A4 [Vitis vinif... 67 1e-09 emb|CBI14925.3| unnamed protein product [Vitis vinifera] 67 1e-09 emb|CAN67678.1| hypothetical protein VITISV_035274 [Vitis vinifera] 67 1e-09 ref|XP_003529310.1| PREDICTED: cytochrome P450 71A4-like [Glycin... 64 1e-08 >ref|XP_002511294.1| cytochrome P450, putative [Ricinus communis] gi|223550409|gb|EEF51896.1| cytochrome P450, putative [Ricinus communis] Length = 508 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 423 EFVLANLLHKFYWKLPNGITVENLDMSESTGVTVHRKVPLLAVAT 289 E LANLLHKF W LP+G+ ++LDM+ES G+TVHRK PLLAVAT Sbjct: 460 ELALANLLHKFDWALPDGVKEDDLDMTESVGLTVHRKFPLLAVAT 504 >ref|XP_002276812.2| PREDICTED: cytochrome P450 71A4 [Vitis vinifera] Length = 488 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -1 Query: 423 EFVLANLLHKFYWKLPNGITVENLDMSESTGVTVHRKVPLLAVATSC 283 E VLANL++KF W LP+G E+LDM+E TG+T+HRK PLLAV+T C Sbjct: 441 ELVLANLVNKFDWALPDGARAEDLDMTECTGLTIHRKFPLLAVSTPC 487 >emb|CBI14925.3| unnamed protein product [Vitis vinifera] Length = 457 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -1 Query: 423 EFVLANLLHKFYWKLPNGITVENLDMSESTGVTVHRKVPLLAVATSC 283 E VLANL++KF W LP+G E+LDM+E TG+T+HRK PLLAV+T C Sbjct: 410 ELVLANLVNKFDWALPDGARAEDLDMTECTGLTIHRKFPLLAVSTPC 456 >emb|CAN67678.1| hypothetical protein VITISV_035274 [Vitis vinifera] Length = 505 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -1 Query: 423 EFVLANLLHKFYWKLPNGITVENLDMSESTGVTVHRKVPLLAVATSC 283 E VLANL++KF W LP+G E+LDM+E TG+T+HRK PLLAV+T C Sbjct: 458 ELVLANLVNKFDWALPDGARAEDLDMTECTGLTIHRKFPLLAVSTPC 504 >ref|XP_003529310.1| PREDICTED: cytochrome P450 71A4-like [Glycine max] Length = 512 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -1 Query: 423 EFVLANLLHKFYWKLPNGITVENLDMSESTGVTVHRKVPLLAVATS 286 E VLANL+H+F W LP G E+LDMSE+ G+ VHRK PLLAVAT+ Sbjct: 463 EVVLANLVHQFDWSLPGGAAGEDLDMSETAGLAVHRKSPLLAVATA 508