BLASTX nr result
ID: Cnidium21_contig00006831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00006831 (645 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275197.2| PREDICTED: protein OSB2, chloroplastic [Viti... 88 1e-15 emb|CBI17930.3| unnamed protein product [Vitis vinifera] 88 1e-15 ref|XP_002520978.1| single-stranded DNA-binding protein, ssb, pu... 87 2e-15 ref|XP_002306816.1| predicted protein [Populus trichocarpa] gi|2... 85 1e-14 ref|XP_002302076.1| predicted protein [Populus trichocarpa] gi|2... 84 3e-14 >ref|XP_002275197.2| PREDICTED: protein OSB2, chloroplastic [Vitis vinifera] Length = 292 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/56 (67%), Positives = 48/56 (85%) Frame = -3 Query: 415 QGTQFPRPTEIEWRKEICNSVQLIGNVGTPVQIKHLSSGKVVAWSRLAVKKSPTDT 248 Q +PRP+E+ W+KE+CNSV LIG VG PV+IKHLSSGKV+AW+RLAV+KS +DT Sbjct: 61 QAVSYPRPSEVPWKKELCNSVSLIGIVGAPVEIKHLSSGKVLAWTRLAVRKSASDT 116 >emb|CBI17930.3| unnamed protein product [Vitis vinifera] Length = 286 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/56 (67%), Positives = 48/56 (85%) Frame = -3 Query: 415 QGTQFPRPTEIEWRKEICNSVQLIGNVGTPVQIKHLSSGKVVAWSRLAVKKSPTDT 248 Q +PRP+E+ W+KE+CNSV LIG VG PV+IKHLSSGKV+AW+RLAV+KS +DT Sbjct: 61 QAVSYPRPSEVPWKKELCNSVSLIGIVGAPVEIKHLSSGKVLAWTRLAVRKSASDT 116 >ref|XP_002520978.1| single-stranded DNA-binding protein, ssb, putative [Ricinus communis] gi|223539815|gb|EEF41395.1| single-stranded DNA-binding protein, ssb, putative [Ricinus communis] Length = 285 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/56 (67%), Positives = 47/56 (83%) Frame = -3 Query: 415 QGTQFPRPTEIEWRKEICNSVQLIGNVGTPVQIKHLSSGKVVAWSRLAVKKSPTDT 248 Q Q+ +PTEI W+K++CNSV LIGNVG PV+IKHL SGKVVAW+RLAVK+S +T Sbjct: 55 QAAQYAKPTEIPWKKDLCNSVNLIGNVGAPVEIKHLPSGKVVAWTRLAVKRSAAET 110 >ref|XP_002306816.1| predicted protein [Populus trichocarpa] gi|222856265|gb|EEE93812.1| predicted protein [Populus trichocarpa] Length = 292 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/57 (68%), Positives = 45/57 (78%) Frame = -3 Query: 415 QGTQFPRPTEIEWRKEICNSVQLIGNVGTPVQIKHLSSGKVVAWSRLAVKKSPTDTA 245 Q +P EI+W KE+CNSV LIG VGTPV+IKHL SGKVVAW+RLAVKKS DT+ Sbjct: 63 QAVTHAKPAEIQWNKELCNSVHLIGIVGTPVEIKHLPSGKVVAWTRLAVKKSANDTS 119 >ref|XP_002302076.1| predicted protein [Populus trichocarpa] gi|222843802|gb|EEE81349.1| predicted protein [Populus trichocarpa] Length = 292 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -3 Query: 397 RPTEIEWRKEICNSVQLIGNVGTPVQIKHLSSGKVVAWSRLAVKKSPTDTA 245 +P EI+W KE+CNSV LIG VG PV+IKHL SGKVVAW+RLAVKKS TDT+ Sbjct: 69 KPAEIQWNKELCNSVHLIGIVGIPVEIKHLPSGKVVAWTRLAVKKSATDTS 119