BLASTX nr result
ID: Cnidium21_contig00006436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00006436 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139521.1| PREDICTED: uncharacterized protein LOC101214... 74 1e-11 gb|ACJ83877.1| unknown [Medicago truncatula] gi|388521237|gb|AFK... 73 2e-11 ref|NP_001238325.1| uncharacterized protein LOC100306660 [Glycin... 72 4e-11 ref|NP_001237907.1| uncharacterized protein LOC100500427 [Glycin... 70 1e-10 emb|CBI39617.3| unnamed protein product [Vitis vinifera] 69 4e-10 >ref|XP_004139521.1| PREDICTED: uncharacterized protein LOC101214389 [Cucumis sativus] gi|449530432|ref|XP_004172199.1| PREDICTED: uncharacterized LOC101214389 [Cucumis sativus] Length = 196 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -2 Query: 400 LSDIYVDDPPTGKITFKTPTGLYRTFPVSAFEIEGSKEATGEVKE 266 LSDIYVDDPPTGKITF+TP GLYRTFPVSAF++E +A E KE Sbjct: 141 LSDIYVDDPPTGKITFQTPAGLYRTFPVSAFQVEEPVKAVSEKKE 185 >gb|ACJ83877.1| unknown [Medicago truncatula] gi|388521237|gb|AFK48680.1| unknown [Medicago truncatula] Length = 170 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -2 Query: 400 LSDIYVDDPPTGKITFKTPTGLYRTFPVSAFEIEGSKEATGEVKEV 263 L DIY+DDPPTGKITFKTP+GL+R+FPVSAFEIE K + VKEV Sbjct: 107 LCDIYIDDPPTGKITFKTPSGLFRSFPVSAFEIEEEKSSGVAVKEV 152 >ref|NP_001238325.1| uncharacterized protein LOC100306660 [Glycine max] gi|255629209|gb|ACU14949.1| unknown [Glycine max] Length = 165 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = -2 Query: 400 LSDIYVDDPPTGKITFKTPTGLYRTFPVSAFEIEGSKEATGEVKEV 263 LSDIYVDDPPTGKITFKTP GL+R+FPVSAFEI+ EA K V Sbjct: 108 LSDIYVDDPPTGKITFKTPAGLFRSFPVSAFEIQEEPEAKDTTKRV 153 >ref|NP_001237907.1| uncharacterized protein LOC100500427 [Glycine max] gi|255630313|gb|ACU15513.1| unknown [Glycine max] Length = 187 Score = 70.5 bits (171), Expect = 1e-10 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -2 Query: 400 LSDIYVDDPPTGKITFKTPTGLYRTFPVSAFEIEGSKEATGEVKE 266 LS+I+VDDPPTGKITFKTP+GL+RTFPVSAFEIE E EVKE Sbjct: 107 LSEIFVDDPPTGKITFKTPSGLFRTFPVSAFEIE---EPVKEVKE 148 >emb|CBI39617.3| unnamed protein product [Vitis vinifera] Length = 135 Score = 68.9 bits (167), Expect = 4e-10 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 14/60 (23%) Frame = -2 Query: 400 LSDIYVDDPPTGKITFKTPTGLYRTFPVSAFEIEGSKE--------------ATGEVKEV 263 LSDIYVDDPPTGKITFKTP GL+R+FPVSAF +E K+ +GEVKEV Sbjct: 65 LSDIYVDDPPTGKITFKTPAGLFRSFPVSAFVLEDVKDVKKAMDVKKAEEEAGSGEVKEV 124