BLASTX nr result
ID: Cnidium21_contig00006392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00006392 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279359.1| PREDICTED: NADP-dependent alkenal double bon... 76 3e-12 gb|ADO51748.1| alcohol dehydrogenase [Camellia sinensis] 73 3e-11 gb|ABW86885.1| pulegone reductase [Mentha x piperita] 73 3e-11 sp|Q6WAU0.1|PULR_MENPI RecName: Full=(+)-pulegone reductase gi|3... 73 3e-11 ref|XP_002309725.1| predicted protein [Populus trichocarpa] gi|2... 72 6e-11 >ref|XP_002279359.1| PREDICTED: NADP-dependent alkenal double bond reductase P2 [Vitis vinifera] gi|147792339|emb|CAN61471.1| hypothetical protein VITISV_043825 [Vitis vinifera] Length = 345 Score = 75.9 bits (185), Expect = 3e-12 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +1 Query: 1 RLEGFLVCDYYHLYPKFLELVLPYIKEGKINYLEDTAEGLES 126 R+EGFLV DYYHLYPKFL+L++PYI+EGKI Y+ED AEGLES Sbjct: 280 RMEGFLVFDYYHLYPKFLDLIMPYIREGKIVYVEDIAEGLES 321 >gb|ADO51748.1| alcohol dehydrogenase [Camellia sinensis] Length = 347 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +1 Query: 1 RLEGFLVCDYYHLYPKFLELVLPYIKEGKINYLEDTAEGLES 126 R+EGF+V DYYHLYPKFLE++LP IK GKI Y+ED AEGLES Sbjct: 282 RMEGFIVFDYYHLYPKFLEMILPCIKGGKITYVEDVAEGLES 323 >gb|ABW86885.1| pulegone reductase [Mentha x piperita] Length = 342 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +1 Query: 1 RLEGFLVCDYYHLYPKFLELVLPYIKEGKINYLEDTAEGLES 126 R++GF+V DYYHLYPKFLE+VLP IKEGK+ Y+ED +EGLES Sbjct: 277 RMQGFVVVDYYHLYPKFLEMVLPCIKEGKVTYVEDISEGLES 318 >sp|Q6WAU0.1|PULR_MENPI RecName: Full=(+)-pulegone reductase gi|34559418|gb|AAQ75423.1| (+)-pulegone reductase [Mentha x piperita] Length = 342 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +1 Query: 1 RLEGFLVCDYYHLYPKFLELVLPYIKEGKINYLEDTAEGLES 126 R++GF+V DYYHLYPKFLE+VLP IKEGK+ Y+ED +EGLES Sbjct: 277 RMQGFVVVDYYHLYPKFLEMVLPRIKEGKVTYVEDISEGLES 318 >ref|XP_002309725.1| predicted protein [Populus trichocarpa] gi|222852628|gb|EEE90175.1| predicted protein [Populus trichocarpa] Length = 345 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +1 Query: 1 RLEGFLVCDYYHLYPKFLELVLPYIKEGKINYLEDTAEGLES 126 R++GFL YYHLYPKFLE+ LPYIK+GKI Y+ED AEGLES Sbjct: 280 RMQGFLAASYYHLYPKFLEMALPYIKQGKIVYVEDKAEGLES 321