BLASTX nr result
ID: Cnidium21_contig00006269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00006269 (934 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512414.1| conserved hypothetical protein [Ricinus comm... 59 2e-06 ref|XP_002516905.1| conserved hypothetical protein [Ricinus comm... 57 8e-06 >ref|XP_002512414.1| conserved hypothetical protein [Ricinus communis] gi|223548375|gb|EEF49866.1| conserved hypothetical protein [Ricinus communis] Length = 279 Score = 58.5 bits (140), Expect = 2e-06 Identities = 35/65 (53%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Frame = +3 Query: 3 GKAKGELNFSYQFSEKIRASHVPHQANHVTSKTDEPVTAYPAVAPM-SAGTSSTYPPPVT 179 GKAKG LNFS++F EK A +A +V EPV AYPA A AG SS YPPP Sbjct: 122 GKAKGSLNFSFKFGEKFEAPLPTEKAKNV----HEPVVAYPAPAGYPGAGASSAYPPP-- 175 Query: 180 SAYPP 194 AYPP Sbjct: 176 GAYPP 180 >ref|XP_002516905.1| conserved hypothetical protein [Ricinus communis] gi|223543993|gb|EEF45519.1| conserved hypothetical protein [Ricinus communis] Length = 283 Score = 56.6 bits (135), Expect = 8e-06 Identities = 33/77 (42%), Positives = 43/77 (55%), Gaps = 13/77 (16%) Frame = +3 Query: 3 GKAKGELNFSYQFSEKIRASHVPHQANHVTSKTDEPVTAYPAVAPM----------SAGT 152 GK+KGEL+FS++FS+KI AS + + K D+P+TAYP VAP G Sbjct: 126 GKSKGELSFSFKFSDKIVAS----GSEKASDKVDQPITAYPVVAPAVGPSAAVAAPYGGP 181 Query: 153 SSTYPPPVTS---AYPP 194 YPPP + AYPP Sbjct: 182 GGPYPPPPMAAGYAYPP 198