BLASTX nr result
ID: Cnidium21_contig00006126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00006126 (570 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADE42968.1| putative photosystem I reaction center subunit [G... 65 1e-08 gb|AEC11003.1| photosystem I reaction center subunit N [Camellia... 61 1e-07 ref|NP_001236569.1| uncharacterized protein LOC100306036 [Glycin... 61 1e-07 ref|NP_001235206.1| uncharacterized protein LOC100499729 [Glycin... 61 1e-07 ref|XP_004163047.1| PREDICTED: photosystem I reaction center sub... 60 2e-07 >gb|ADE42968.1| putative photosystem I reaction center subunit [Gardenia jasminoides] Length = 169 Score = 64.7 bits (156), Expect = 1e-08 Identities = 37/62 (59%), Positives = 46/62 (74%), Gaps = 2/62 (3%) Frame = +1 Query: 1 IRAQNVKDSDSSEHRNDGSQGRRAALVCLGAALF--ATATSSANAGPIEDALERSKTNKD 174 I+AQ + S+S E SQGRRAA++CL AALF A +TSSANAG IE+ LE+SK NK+ Sbjct: 43 IKAQQTRVSESKESE---SQGRRAAMLCLAAALFTAAASTSSANAGVIEEYLEKSKANKE 99 Query: 175 LN 180 LN Sbjct: 100 LN 101 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +1 Query: 343 FISDDIELECKGKDKYKCGSNVFWKW 420 F+SDD++LE KGKDKYKCGSNVFWKW Sbjct: 144 FLSDDLDLERKGKDKYKCGSNVFWKW 169 >gb|AEC11003.1| photosystem I reaction center subunit N [Camellia sinensis] Length = 174 Score = 60.8 bits (146), Expect = 1e-07 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +1 Query: 343 FISDDIELECKGKDKYKCGSNVFWKW 420 F+S+D+ELECKGKDKYKCGSNVFWKW Sbjct: 149 FLSEDLELECKGKDKYKCGSNVFWKW 174 >ref|NP_001236569.1| uncharacterized protein LOC100306036 [Glycine max] gi|255627347|gb|ACU14018.1| unknown [Glycine max] Length = 166 Score = 60.8 bits (146), Expect = 1e-07 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +1 Query: 343 FISDDIELECKGKDKYKCGSNVFWKW 420 F+SDD+ELEC+GKDKYKCGSNVFWKW Sbjct: 141 FLSDDLELECEGKDKYKCGSNVFWKW 166 >ref|NP_001235206.1| uncharacterized protein LOC100499729 [Glycine max] gi|255626111|gb|ACU13400.1| unknown [Glycine max] Length = 167 Score = 60.8 bits (146), Expect = 1e-07 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +1 Query: 343 FISDDIELECKGKDKYKCGSNVFWKW 420 F+SDD+ELEC+GKDKYKCGSNVFWKW Sbjct: 142 FLSDDLELECEGKDKYKCGSNVFWKW 167 >ref|XP_004163047.1| PREDICTED: photosystem I reaction center subunit N, chloroplastic-like [Cucumis sativus] Length = 171 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +1 Query: 343 FISDDIELECKGKDKYKCGSNVFWKW 420 FI+DD+ELEC+GKDKYKCGSNVFWKW Sbjct: 146 FITDDLELECEGKDKYKCGSNVFWKW 171 Score = 55.5 bits (132), Expect = 6e-06 Identities = 37/64 (57%), Positives = 42/64 (65%), Gaps = 4/64 (6%) Frame = +1 Query: 1 IRAQNVKDSDSSEHRNDGSQGRRAALVCLGAALFATAT----SSANAGPIEDALERSKTN 168 IRAQ K E +NDG RR AL+ LGA+LFA A SSANAG IED LE+SK N Sbjct: 46 IRAQQAK---VPEAKNDG---RRTALLYLGASLFAAAAAASNSSANAGVIEDYLEKSKAN 99 Query: 169 KDLN 180 K+LN Sbjct: 100 KELN 103