BLASTX nr result
ID: Cnidium21_contig00006102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00006102 (556 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274465.2| PREDICTED: uncharacterized protein LOC100250... 57 3e-06 emb|CAN60165.1| hypothetical protein VITISV_040087 [Vitis vinifera] 57 3e-06 ref|XP_002514688.1| hypothetical protein RCOM_1470460 [Ricinus c... 56 4e-06 >ref|XP_002274465.2| PREDICTED: uncharacterized protein LOC100250913 [Vitis vinifera] Length = 550 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/51 (54%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = +3 Query: 27 YSLDSCDSKVWDERYPVGSMTSVDLLPTCNMMEEIFGPCNWN-KSNNDKCL 176 Y L+ ++KVWD RY GS+ VDLLPTCNM+EEIFG N K+ +DK + Sbjct: 499 YLLEPSETKVWDGRYWTGSINGVDLLPTCNMIEEIFGLGTPNSKTKDDKSI 549 >emb|CAN60165.1| hypothetical protein VITISV_040087 [Vitis vinifera] Length = 605 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/51 (54%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = +3 Query: 27 YSLDSCDSKVWDERYPVGSMTSVDLLPTCNMMEEIFGPCNWN-KSNNDKCL 176 Y L+ ++KVWD RY GS+ VDLLPTCNM+EEIFG N K+ +DK + Sbjct: 554 YLLEPSETKVWDGRYWTGSINGVDLLPTCNMIEEIFGLGTPNSKTKDDKSI 604 >ref|XP_002514688.1| hypothetical protein RCOM_1470460 [Ricinus communis] gi|223546292|gb|EEF47794.1| hypothetical protein RCOM_1470460 [Ricinus communis] Length = 473 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/43 (53%), Positives = 32/43 (74%) Frame = +3 Query: 24 HYSLDSCDSKVWDERYPVGSMTSVDLLPTCNMMEEIFGPCNWN 152 H+S +SCD K+WD Y + + VDLLPTC+M+EE+FG +WN Sbjct: 412 HFS-ESCDVKIWDAGYMICPKSKVDLLPTCSMIEEVFGDGSWN 453