BLASTX nr result
ID: Cnidium21_contig00006008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00006008 (533 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001758755.1| predicted protein [Physcomitrella patens sub... 84 2e-14 ref|XP_001764044.1| predicted protein [Physcomitrella patens sub... 82 4e-14 ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1... 82 5e-14 ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [S... 82 6e-14 gb|ABK21382.1| unknown [Picea sitchensis] 82 6e-14 >ref|XP_001758755.1| predicted protein [Physcomitrella patens subsp. patens] gi|162689892|gb|EDQ76261.1| predicted protein [Physcomitrella patens subsp. patens] Length = 56 Score = 83.6 bits (205), Expect = 2e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +3 Query: 150 KPLKEWPTWFLKKAKVVAHYGFIPLIIVIGMNTEPKPSIAQLLSPV 287 K +KEWPTW LKKAK V HYGFIPLII IGMNTEPKP ++QLLSPV Sbjct: 11 KLIKEWPTWILKKAKTVTHYGFIPLIIFIGMNTEPKPQLSQLLSPV 56 >ref|XP_001764044.1| predicted protein [Physcomitrella patens subsp. patens] gi|162684783|gb|EDQ71183.1| predicted protein [Physcomitrella patens subsp. patens] Length = 56 Score = 82.4 bits (202), Expect = 4e-14 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +3 Query: 150 KPLKEWPTWFLKKAKVVAHYGFIPLIIVIGMNTEPKPSIAQLLSPV 287 K +KEWPTW LKKAK V HYGFIPLII IGMNT+PKP ++QLLSPV Sbjct: 11 KLIKEWPTWILKKAKTVTHYGFIPLIIFIGMNTDPKPQLSQLLSPV 56 >ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195606532|gb|ACG25096.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195637638|gb|ACG38287.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195658849|gb|ACG48892.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|223945683|gb|ACN26925.1| unknown [Zea mays] gi|413950686|gb|AFW83335.1| import receptor subunit TOM7-1 [Zea mays] Length = 79 Score = 82.0 bits (201), Expect = 5e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 156 LKEWPTWFLKKAKVVAHYGFIPLIIVIGMNTEPKPSIAQLLSPV 287 +KEW TW +KKAKVVAHYGFIPL+IVIGMN+EPKPS+ QLLSPV Sbjct: 36 MKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] gi|241930169|gb|EES03314.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] Length = 79 Score = 81.6 bits (200), Expect = 6e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 156 LKEWPTWFLKKAKVVAHYGFIPLIIVIGMNTEPKPSIAQLLSPV 287 +KEW TW +KKAKVVAHYGFIPL+IVIGMN+EPKPS+ QLLSPV Sbjct: 36 VKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >gb|ABK21382.1| unknown [Picea sitchensis] Length = 72 Score = 81.6 bits (200), Expect = 6e-14 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +3 Query: 150 KPLKEWPTWFLKKAKVVAHYGFIPLIIVIGMNTEPKPSIAQLLSPV 287 K +KEW TW +K+AK V HYGFIPL+I+IGMN+EPKPSIAQLLSPV Sbjct: 27 KAVKEWTTWVMKRAKTVTHYGFIPLVIIIGMNSEPKPSIAQLLSPV 72