BLASTX nr result
ID: Cnidium21_contig00005766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00005766 (1388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003519723.1| PREDICTED: pentatricopeptide repeat-containi... 62 5e-07 >ref|XP_003519723.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Glycine max] Length = 727 Score = 61.6 bits (148), Expect = 5e-07 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = +2 Query: 1274 SHAGLVDKGWSLFNSMINNHGMQPDMEPYSCMVDHVWR 1387 SHAGL+D+GW L+NSMIN++G++P+ME YSCMVD + R Sbjct: 547 SHAGLLDRGWLLYNSMINDYGIEPNMEHYSCMVDLIGR 584