BLASTX nr result
ID: Cnidium21_contig00005676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00005676 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514140.1| cytidine deaminase 1, 2, 7, putative [Ricinu... 57 1e-06 ref|XP_002282373.1| PREDICTED: cytidine deaminase-like [Vitis vi... 54 1e-05 >ref|XP_002514140.1| cytidine deaminase 1, 2, 7, putative [Ricinus communis] gi|223546596|gb|EEF48094.1| cytidine deaminase 1, 2, 7, putative [Ricinus communis] Length = 311 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 3 VEKEEAVVSQEDTARLLLKMVSPNCDFRVFHCCSS 107 VEKEEAVV QE TARLLL+++SP C+F+VFHC SS Sbjct: 275 VEKEEAVVRQEFTARLLLQVISPRCEFKVFHCSSS 309 >ref|XP_002282373.1| PREDICTED: cytidine deaminase-like [Vitis vinifera] Length = 301 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 3 VEKEEAVVSQEDTARLLLKMVSPNCDFRVFHCCSS 107 VEKEEA V QE TARLLL ++SP C+FRVF+C S+ Sbjct: 263 VEKEEAQVKQEQTARLLLNLISPKCEFRVFYCSSA 297