BLASTX nr result
ID: Cnidium21_contig00005536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00005536 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298232.1| predicted protein [Populus trichocarpa] gi|2... 82 3e-14 ref|XP_002516000.1| nucleic acid binding protein, putative [Rici... 82 6e-14 emb|CBI36104.3| unnamed protein product [Vitis vinifera] 81 8e-14 ref|XP_002279009.1| PREDICTED: uncharacterized protein LOC100266... 81 8e-14 emb|CAN70339.1| hypothetical protein VITISV_011439 [Vitis vinifera] 81 8e-14 >ref|XP_002298232.1| predicted protein [Populus trichocarpa] gi|222845490|gb|EEE83037.1| predicted protein [Populus trichocarpa] Length = 440 Score = 82.4 bits (202), Expect = 3e-14 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 308 GIVEQFGSEEWGEYLIREAHLSRRFVYDENGYYQCRASIPFPEK 177 GI +QFGSE+WGEYLIREAHLS+RFV+DENGYY C ASIPFP K Sbjct: 390 GIFKQFGSEDWGEYLIREAHLSQRFVFDENGYYHCCASIPFPGK 433 >ref|XP_002516000.1| nucleic acid binding protein, putative [Ricinus communis] gi|223544905|gb|EEF46420.1| nucleic acid binding protein, putative [Ricinus communis] Length = 416 Score = 81.6 bits (200), Expect = 6e-14 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 308 GIVEQFGSEEWGEYLIREAHLSRRFVYDENGYYQCRASIPFPE 180 GI +QFGSEEWGEY IREAHLS+RFV+DENGYY C ASIPFPE Sbjct: 369 GIFKQFGSEEWGEYPIREAHLSQRFVFDENGYYHCCASIPFPE 411 >emb|CBI36104.3| unnamed protein product [Vitis vinifera] Length = 923 Score = 81.3 bits (199), Expect = 8e-14 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 308 GIVEQFGSEEWGEYLIREAHLSRRFVYDENGYYQCRASIPFPE 180 GI +Q+GSEEWG+Y+IREAHLS+RFV+DENGYY C ASIPFPE Sbjct: 876 GIFKQYGSEEWGDYIIREAHLSQRFVFDENGYYHCCASIPFPE 918 >ref|XP_002279009.1| PREDICTED: uncharacterized protein LOC100266864 [Vitis vinifera] Length = 476 Score = 81.3 bits (199), Expect = 8e-14 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 308 GIVEQFGSEEWGEYLIREAHLSRRFVYDENGYYQCRASIPFPE 180 GI +Q+GSEEWG+Y+IREAHLS+RFV+DENGYY C ASIPFPE Sbjct: 429 GIFKQYGSEEWGDYIIREAHLSQRFVFDENGYYHCCASIPFPE 471 >emb|CAN70339.1| hypothetical protein VITISV_011439 [Vitis vinifera] Length = 137 Score = 81.3 bits (199), Expect = 8e-14 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 308 GIVEQFGSEEWGEYLIREAHLSRRFVYDENGYYQCRASIPFPE 180 GI +Q+GSEEWG+Y+IREAHLS+RFV+DENGYY C ASIPFPE Sbjct: 90 GIFKQYGSEEWGDYIIREAHLSQRFVFDENGYYHCCASIPFPE 132