BLASTX nr result
ID: Cnidium21_contig00005116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00005116 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001057513.1| Os06g0320500 [Oryza sativa Japonica Group] g... 87 1e-15 gb|AFW70293.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7... 87 1e-15 ref|XP_002451621.1| hypothetical protein SORBIDRAFT_04g004770 [S... 87 1e-15 ref|NP_001148183.1| chlorophyll a-b binding protein 6A [Zea mays... 87 1e-15 ref|NP_001149586.1| chlorophyll a-b binding protein 6A [Zea mays... 87 1e-15 >ref|NP_001057513.1| Os06g0320500 [Oryza sativa Japonica Group] gi|3789954|gb|AAC67558.1| chlorophyll a/b-binding protein precursor [Oryza sativa Japonica Group] gi|54290899|dbj|BAD61582.1| chlorophyll a/b-binding protein precursor [Oryza sativa Japonica Group] gi|113595553|dbj|BAF19427.1| Os06g0320500 [Oryza sativa Japonica Group] gi|125597037|gb|EAZ36817.1| hypothetical protein OsJ_21156 [Oryza sativa Japonica Group] gi|215686348|dbj|BAG87609.1| unnamed protein product [Oryza sativa Japonica Group] gi|215704347|dbj|BAG93781.1| unnamed protein product [Oryza sativa Japonica Group] Length = 241 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -2 Query: 128 TSSKFTMSAEWMPGQPRPAHLDGSTPGDFGFDPLGLATVPEN 3 TS + TMSAEWMPGQPRPAHLDGS+PGDFGFDPLGLATVPEN Sbjct: 35 TSGRVTMSAEWMPGQPRPAHLDGSSPGDFGFDPLGLATVPEN 76 >gb|AFW70293.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_802965, partial [Zea mays] Length = 273 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -2 Query: 128 TSSKFTMSAEWMPGQPRPAHLDGSTPGDFGFDPLGLATVPEN 3 TS + TMSAEWMPGQPRPAHLDGS+PGDFGFDPLGLATVPEN Sbjct: 39 TSGRVTMSAEWMPGQPRPAHLDGSSPGDFGFDPLGLATVPEN 80 >ref|XP_002451621.1| hypothetical protein SORBIDRAFT_04g004770 [Sorghum bicolor] gi|241931452|gb|EES04597.1| hypothetical protein SORBIDRAFT_04g004770 [Sorghum bicolor] Length = 245 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -2 Query: 128 TSSKFTMSAEWMPGQPRPAHLDGSTPGDFGFDPLGLATVPEN 3 TS + TMSAEWMPGQPRPAHLDGS+PGDFGFDPLGLATVPEN Sbjct: 39 TSGRVTMSAEWMPGQPRPAHLDGSSPGDFGFDPLGLATVPEN 80 >ref|NP_001148183.1| chlorophyll a-b binding protein 6A [Zea mays] gi|195612072|gb|ACG27866.1| chlorophyll a-b binding protein 6A [Zea mays] gi|195616508|gb|ACG30084.1| chlorophyll a-b binding protein 6A [Zea mays] gi|223975041|gb|ACN31708.1| unknown [Zea mays] gi|413935743|gb|AFW70294.1| chlorophyll a-b binding protein 6A [Zea mays] Length = 245 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -2 Query: 128 TSSKFTMSAEWMPGQPRPAHLDGSTPGDFGFDPLGLATVPEN 3 TS + TMSAEWMPGQPRPAHLDGS+PGDFGFDPLGLATVPEN Sbjct: 39 TSGRVTMSAEWMPGQPRPAHLDGSSPGDFGFDPLGLATVPEN 80 >ref|NP_001149586.1| chlorophyll a-b binding protein 6A [Zea mays] gi|194706946|gb|ACF87557.1| unknown [Zea mays] gi|195628244|gb|ACG35952.1| chlorophyll a-b binding protein 6A [Zea mays] gi|413926425|gb|AFW66357.1| chlorophyll a-b binding protein 6A [Zea mays] Length = 249 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -2 Query: 128 TSSKFTMSAEWMPGQPRPAHLDGSTPGDFGFDPLGLATVPEN 3 TS + TMSAEWMPGQPRPAHLDGS+PGDFGFDPLGLATVPEN Sbjct: 43 TSGRVTMSAEWMPGQPRPAHLDGSSPGDFGFDPLGLATVPEN 84