BLASTX nr result
ID: Cnidium21_contig00004934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00004934 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulga... 40 1e-06 >emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1389 Score = 40.0 bits (92), Expect(2) = 1e-06 Identities = 22/53 (41%), Positives = 29/53 (54%) Frame = -2 Query: 293 GRWNIPKLKEHVSDEIVDRITAILISHSYAADGLMRHYTSNGIYSIKSGYRLL 135 G W+IPKL V IV I+++ I S D L+ T G YS+KSG L+ Sbjct: 984 GGWDIPKLLTLVPPNIVKAISSVFIPSSSQQDRLLWGLTPTGQYSVKSGASLI 1036 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = -1 Query: 81 DKYFWNQIWSISAQPKMKNFMWRLCSN 1 +K +N IW I A PK+KNF+W+ C++ Sbjct: 1045 EKVEFNWIWGIHAPPKIKNFLWKACND 1071