BLASTX nr result
ID: Cnidium21_contig00004877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00004877 (437 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|D7T737.1|MTND1_VITVI RecName: Full=1,2-dihydroxy-3-keto-5-met... 62 6e-08 emb|CAN82006.1| hypothetical protein VITISV_007261 [Vitis vinifera] 62 6e-08 gb|AFK44644.1| unknown [Medicago truncatula] 60 2e-07 ref|XP_003536514.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthio... 59 3e-07 ref|XP_002517074.1| acireductone dioxygenase, putative [Ricinus ... 59 4e-07 >sp|D7T737.1|MTND1_VITVI RecName: Full=1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1; AltName: Full=Acireductone dioxygenase (Fe(2+)-requiring) 1; Short=ARD 1; Short=Fe-ARD 1 gi|297737107|emb|CBI26308.3| unnamed protein product [Vitis vinifera] Length = 188 Score = 61.6 bits (148), Expect = 6e-08 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -2 Query: 436 GEPVWTAHNRPQDNHPSRREYIKNFCEKVGTPLDAH 329 GEPVWTA+NRPQ++HP+R+ YI N KVG PL+AH Sbjct: 153 GEPVWTAYNRPQEHHPARKNYINNVTHKVGVPLEAH 188 >emb|CAN82006.1| hypothetical protein VITISV_007261 [Vitis vinifera] Length = 187 Score = 61.6 bits (148), Expect = 6e-08 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -2 Query: 436 GEPVWTAHNRPQDNHPSRREYIKNFCEKVGTPLDAH 329 GEPVWTA+NRPQ++HP+R+ YI N KVG PL+AH Sbjct: 152 GEPVWTAYNRPQEHHPARKNYINNXTHKVGVPLEAH 187 >gb|AFK44644.1| unknown [Medicago truncatula] Length = 187 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -2 Query: 436 GEPVWTAHNRPQDNHPSRREYIKNFCEKVGTPLDAH 329 GEPVWTA+NRPQ+++P+R+EYIK EK G PL AH Sbjct: 152 GEPVWTAYNRPQEDNPARKEYIKGLTEKTGVPLAAH 187 >ref|XP_003536514.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 4 [Glycine max] Length = 187 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -2 Query: 436 GEPVWTAHNRPQDNHPSRREYIKNFCEKVGTPLDAH 329 GEPVWTA+NRPQ+++P+R+EYIK EK G PL AH Sbjct: 152 GEPVWTAYNRPQEDNPARKEYIKGLTEKFGVPLAAH 187 >ref|XP_002517074.1| acireductone dioxygenase, putative [Ricinus communis] gi|223543709|gb|EEF45237.1| acireductone dioxygenase, putative [Ricinus communis] Length = 187 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 436 GEPVWTAHNRPQDNHPSRREYIKNFCEKVGTPLDAH 329 GEPVWT NRPQ++HP+R+EYIK+ EKVG L AH Sbjct: 152 GEPVWTPFNRPQEDHPARKEYIKSLTEKVGVALQAH 187