BLASTX nr result
ID: Cnidium21_contig00004876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00004876 (604 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517074.1| acireductone dioxygenase, putative [Ricinus ... 57 3e-06 ref|NP_001236515.1| uncharacterized protein LOC100500592 [Glycin... 56 4e-06 sp|D7T737.1|MTND1_VITVI RecName: Full=1,2-dihydroxy-3-keto-5-met... 55 7e-06 gb|AFK44644.1| unknown [Medicago truncatula] 55 1e-05 ref|XP_002311640.1| predicted protein [Populus trichocarpa] gi|2... 55 1e-05 >ref|XP_002517074.1| acireductone dioxygenase, putative [Ricinus communis] gi|223543709|gb|EEF45237.1| acireductone dioxygenase, putative [Ricinus communis] Length = 187 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -2 Query: 603 GEPVWTAYNRPQDNHPSRREYIKNLCEKVGTGI 505 GEPVWT +NRPQ++HP+R+EYIK+L EKVG + Sbjct: 152 GEPVWTPFNRPQEDHPARKEYIKSLTEKVGVAL 184 >ref|NP_001236515.1| uncharacterized protein LOC100500592 [Glycine max] gi|255630714|gb|ACU15718.1| unknown [Glycine max] Length = 187 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -2 Query: 603 GEPVWTAYNRPQDNHPSRREYIKNLCEKVGTGIGT 499 GEPVWTAYNRPQ+++P+R+EYIK L EK G + T Sbjct: 152 GEPVWTAYNRPQEDNPARKEYIKGLTEKSGVPLAT 186 >sp|D7T737.1|MTND1_VITVI RecName: Full=1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1; AltName: Full=Acireductone dioxygenase (Fe(2+)-requiring) 1; Short=ARD 1; Short=Fe-ARD 1 gi|297737107|emb|CBI26308.3| unnamed protein product [Vitis vinifera] Length = 188 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -2 Query: 603 GEPVWTAYNRPQDNHPSRREYIKNLCEKVGTGIGTPVEA 487 GEPVWTAYNRPQ++HP+R+ YI N+ KV G P+EA Sbjct: 153 GEPVWTAYNRPQEHHPARKNYINNVTHKV----GVPLEA 187 >gb|AFK44644.1| unknown [Medicago truncatula] Length = 187 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -2 Query: 603 GEPVWTAYNRPQDNHPSRREYIKNLCEKVG 514 GEPVWTAYNRPQ+++P+R+EYIK L EK G Sbjct: 152 GEPVWTAYNRPQEDNPARKEYIKGLTEKTG 181 >ref|XP_002311640.1| predicted protein [Populus trichocarpa] gi|222851460|gb|EEE89007.1| predicted protein [Populus trichocarpa] Length = 189 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/34 (67%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = -2 Query: 603 GEPVWTAYNRPQDNHPSRREYIKNL-CEKVGTGI 505 GEPVWTAYNRPQ++HP+R+EYIK++ EKVG + Sbjct: 153 GEPVWTAYNRPQEDHPARKEYIKSMVTEKVGVAL 186