BLASTX nr result
ID: Cnidium21_contig00004585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00004585 (552 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547586.1| PREDICTED: cytochrome b-c1 complex subunit 6... 70 3e-10 ref|XP_003531564.1| PREDICTED: cytochrome b-c1 complex subunit 6... 70 3e-10 ref|XP_004140689.1| PREDICTED: cytochrome b-c1 complex subunit 6... 69 5e-10 ref|XP_002532440.1| Ubiquinol-cytochrome c reductase complex 7.8... 68 9e-10 ref|XP_002300923.1| predicted protein [Populus trichocarpa] gi|2... 68 1e-09 >ref|XP_003547586.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Glycine max] gi|255630456|gb|ACU15586.1| unknown [Glycine max] Length = 69 Score = 69.7 bits (169), Expect = 3e-10 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +1 Query: 88 MADEDPSDQKKYLEDSCKPKCVKPLLEYQACVQRI 192 MADE+P DQK+YLE+SCKPKCVKPLLEYQAC++RI Sbjct: 1 MADEEPVDQKRYLEESCKPKCVKPLLEYQACIKRI 35 >ref|XP_003531564.1| PREDICTED: cytochrome b-c1 complex subunit 6 [Glycine max] gi|255628593|gb|ACU14641.1| unknown [Glycine max] Length = 69 Score = 69.7 bits (169), Expect = 3e-10 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +1 Query: 88 MADEDPSDQKKYLEDSCKPKCVKPLLEYQACVQRI 192 MADE+P DQK+YLE+SCKPKCVKPLLEYQAC++RI Sbjct: 1 MADEEPVDQKRYLEESCKPKCVKPLLEYQACIKRI 35 >ref|XP_004140689.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Cucumis sativus] gi|449528698|ref|XP_004171340.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Cucumis sativus] Length = 69 Score = 68.9 bits (167), Expect = 5e-10 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +1 Query: 88 MADEDPSDQKKYLEDSCKPKCVKPLLEYQACVQRI 192 MADE+P DQK+YLE++CKPKCVKPLLEYQACV+RI Sbjct: 1 MADEEPVDQKRYLEEACKPKCVKPLLEYQACVKRI 35 >ref|XP_002532440.1| Ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative [Ricinus communis] gi|223527860|gb|EEF29955.1| Ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative [Ricinus communis] Length = 110 Score = 68.2 bits (165), Expect = 9e-10 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +1 Query: 91 ADEDPSDQKKYLEDSCKPKCVKPLLEYQACVQRI 192 ADE+P DQKKYLE+SCKPKCVKPLLEY+ACV+RI Sbjct: 36 ADEEPVDQKKYLEESCKPKCVKPLLEYEACVKRI 69 >ref|XP_002300923.1| predicted protein [Populus trichocarpa] gi|222842649|gb|EEE80196.1| predicted protein [Populus trichocarpa] Length = 69 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 88 MADEDPSDQKKYLEDSCKPKCVKPLLEYQACVQRI 192 MADE+P D KKYLE+SCKPKCV+PLLEYQACV+RI Sbjct: 1 MADEEPVDPKKYLEESCKPKCVRPLLEYQACVKRI 35