BLASTX nr result
ID: Cnidium21_contig00004514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00004514 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155713.1| PREDICTED: SNF1-related protein kinase regul... 91 1e-16 ref|XP_004142584.1| PREDICTED: LOW QUALITY PROTEIN: SNF1-related... 91 1e-16 ref|XP_004138051.1| PREDICTED: SNF1-related protein kinase regul... 91 1e-16 ref|XP_002511194.1| AMP-activated protein kinase, gamma regulato... 88 8e-16 emb|CBI15659.3| unnamed protein product [Vitis vinifera] 87 1e-15 >ref|XP_004155713.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Cucumis sativus] Length = 414 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +3 Query: 282 SGSFRWAPFLALQTSNSFLTMLLLLSTYRMKSVPVVDSGEGKIENIIT 425 SGSFRWAPFLALQTSNSFLTMLLLLS Y+MKS+PVVD GEGKIENIIT Sbjct: 175 SGSFRWAPFLALQTSNSFLTMLLLLSKYKMKSIPVVDLGEGKIENIIT 222 >ref|XP_004142584.1| PREDICTED: LOW QUALITY PROTEIN: SNF1-related protein kinase regulatory subunit gamma-1-like [Cucumis sativus] Length = 414 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +3 Query: 282 SGSFRWAPFLALQTSNSFLTMLLLLSTYRMKSVPVVDSGEGKIENIIT 425 SGSFRWAPFLALQTSNSFLTMLLLLS Y+MKS+PVVD GEGKIENIIT Sbjct: 175 SGSFRWAPFLALQTSNSFLTMLLLLSKYKMKSIPVVDLGEGKIENIIT 222 >ref|XP_004138051.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Cucumis sativus] gi|449523992|ref|XP_004169007.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Cucumis sativus] Length = 414 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +3 Query: 282 SGSFRWAPFLALQTSNSFLTMLLLLSTYRMKSVPVVDSGEGKIENIIT 425 SGSFRWAPFLALQTSNSFLTMLLLLS Y+MKS+PVVD GEGKIENIIT Sbjct: 175 SGSFRWAPFLALQTSNSFLTMLLLLSKYKMKSIPVVDLGEGKIENIIT 222 >ref|XP_002511194.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] gi|223550309|gb|EEF51796.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] Length = 459 Score = 87.8 bits (216), Expect = 8e-16 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +3 Query: 282 SGSFRWAPFLALQTSNSFLTMLLLLSTYRMKSVPVVDSGEGKIENIIT 425 SGSFRWAPFLALQ SNSFLTMLLLLS Y+MKSVPVVD GEGKI+NIIT Sbjct: 219 SGSFRWAPFLALQNSNSFLTMLLLLSKYKMKSVPVVDLGEGKIDNIIT 266 >emb|CBI15659.3| unnamed protein product [Vitis vinifera] Length = 421 Score = 87.4 bits (215), Expect = 1e-15 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +3 Query: 282 SGSFRWAPFLALQTSNSFLTMLLLLSTYRMKSVPVVDSGEGKIENIIT 425 SGSFRWAPFLALQ SNSFLTMLLLLS Y+MKSVPVVD GEGKI+NI+T Sbjct: 181 SGSFRWAPFLALQKSNSFLTMLLLLSNYKMKSVPVVDLGEGKIDNIVT 228