BLASTX nr result
ID: Cnidium21_contig00004493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00004493 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9AT35.1|RL23A_DAUCA RecName: Full=60S ribosomal protein L23a... 86 2e-15 ref|XP_004149813.1| PREDICTED: 60S ribosomal protein L23a-like [... 81 8e-14 ref|XP_004147702.1| PREDICTED: 60S ribosomal protein L23a-like [... 81 8e-14 ref|XP_004140409.1| PREDICTED: 60S ribosomal protein L23a-like i... 81 8e-14 ref|XP_004140408.1| PREDICTED: 60S ribosomal protein L23a-like i... 81 8e-14 >sp|Q9AT35.1|RL23A_DAUCA RecName: Full=60S ribosomal protein L23a gi|13560777|gb|AAK30202.1|AF349961_1 ribosome protein L23a [Daucus carota] Length = 154 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -2 Query: 122 IRTSVTFHRPRTLTKDRNPKYPRISATPRNKLDQYQILKY 3 IRTSVTFHRPRTLTKDRNPKYPRISATPRNKLDQYQILKY Sbjct: 38 IRTSVTFHRPRTLTKDRNPKYPRISATPRNKLDQYQILKY 77 >ref|XP_004149813.1| PREDICTED: 60S ribosomal protein L23a-like [Cucumis sativus] gi|449519086|ref|XP_004166566.1| PREDICTED: 60S ribosomal protein L23a-like [Cucumis sativus] Length = 153 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 122 IRTSVTFHRPRTLTKDRNPKYPRISATPRNKLDQYQILKY 3 IRTSVTFHRP+TL KDRNPKYPRIS TPRNKLDQYQILKY Sbjct: 37 IRTSVTFHRPKTLKKDRNPKYPRISVTPRNKLDQYQILKY 76 >ref|XP_004147702.1| PREDICTED: 60S ribosomal protein L23a-like [Cucumis sativus] gi|449514958|ref|XP_004164525.1| PREDICTED: 60S ribosomal protein L23a-like [Cucumis sativus] Length = 153 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 122 IRTSVTFHRPRTLTKDRNPKYPRISATPRNKLDQYQILKY 3 IRTSVTFHRP+TL KDRNPKYPRIS TPRNKLDQYQILKY Sbjct: 37 IRTSVTFHRPKTLKKDRNPKYPRISVTPRNKLDQYQILKY 76 >ref|XP_004140409.1| PREDICTED: 60S ribosomal protein L23a-like isoform 3 [Cucumis sativus] gi|449498367|ref|XP_004160519.1| PREDICTED: 60S ribosomal protein L23a-like isoform 3 [Cucumis sativus] Length = 146 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 122 IRTSVTFHRPRTLTKDRNPKYPRISATPRNKLDQYQILKY 3 IRTSVTFHRP+TL KDRNPKYPRIS TPRNKLDQYQILKY Sbjct: 30 IRTSVTFHRPKTLKKDRNPKYPRISVTPRNKLDQYQILKY 69 >ref|XP_004140408.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Cucumis sativus] gi|449498363|ref|XP_004160518.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Cucumis sativus] Length = 152 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 122 IRTSVTFHRPRTLTKDRNPKYPRISATPRNKLDQYQILKY 3 IRTSVTFHRP+TL KDRNPKYPRIS TPRNKLDQYQILKY Sbjct: 36 IRTSVTFHRPKTLKKDRNPKYPRISVTPRNKLDQYQILKY 75