BLASTX nr result
ID: Cnidium21_contig00004337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00004337 (431 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604931.1| Serine carboxypeptidase [Medicago truncatula... 82 3e-14 ref|XP_003604927.1| Serine carboxypeptidase [Medicago truncatula... 82 6e-14 ref|NP_973517.1| serine carboxypeptidase-like 9 [Arabidopsis tha... 80 1e-13 ref|XP_003604929.1| Serine carboxypeptidase [Medicago truncatula... 80 1e-13 ref|NP_179884.1| serine carboxypeptidase-like 9 [Arabidopsis tha... 80 1e-13 >ref|XP_003604931.1| Serine carboxypeptidase [Medicago truncatula] gi|355505986|gb|AES87128.1| Serine carboxypeptidase [Medicago truncatula] Length = 470 Score = 82.4 bits (202), Expect = 3e-14 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -2 Query: 430 YSGDHDFVVPFQSTQAWIRELNYSIIDDWRPWIVEGQFAGYT 305 YSGDHD VVPF STQAWIR+LNYSI+DDWRPW V GQ GYT Sbjct: 389 YSGDHDAVVPFMSTQAWIRDLNYSIVDDWRPWFVNGQVGGYT 430 >ref|XP_003604927.1| Serine carboxypeptidase [Medicago truncatula] gi|355505982|gb|AES87124.1| Serine carboxypeptidase [Medicago truncatula] Length = 624 Score = 81.6 bits (200), Expect = 6e-14 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -2 Query: 430 YSGDHDFVVPFQSTQAWIRELNYSIIDDWRPWIVEGQFAGYT 305 YSGDHD VVPF STQAWIR LNYSI+DDWRPW V GQ GYT Sbjct: 387 YSGDHDAVVPFMSTQAWIRNLNYSIVDDWRPWFVNGQVGGYT 428 >ref|NP_973517.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana] gi|330252302|gb|AEC07396.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana] Length = 437 Score = 80.5 bits (197), Expect = 1e-13 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = -2 Query: 430 YSGDHDFVVPFQSTQAWIRELNYSIIDDWRPWIVEGQFAGYT 305 +SGDHD +PFQ+TQAWI+ LNYSIIDDWRPW+++GQ AGYT Sbjct: 357 FSGDHDITMPFQATQAWIKSLNYSIIDDWRPWMIKGQIAGYT 398 >ref|XP_003604929.1| Serine carboxypeptidase [Medicago truncatula] gi|355505984|gb|AES87126.1| Serine carboxypeptidase [Medicago truncatula] Length = 923 Score = 80.5 bits (197), Expect = 1e-13 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -2 Query: 430 YSGDHDFVVPFQSTQAWIRELNYSIIDDWRPWIVEGQFAGYT 305 YSGDHD VVPF STQAWIR LNYSI+DDWRPW V GQ GYT Sbjct: 389 YSGDHDAVVPFISTQAWIRNLNYSIVDDWRPWFVNGQVGGYT 430 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -2 Query: 430 YSGDHDFVVPFQSTQAWIRELNYSIIDDWRPWIVEGQFAGYT 305 YSG D +VPF STQAWIR+LNYS +DDWRPW V GQ GYT Sbjct: 842 YSGVLDAIVPFMSTQAWIRDLNYSTVDDWRPWFVNGQVGGYT 883 >ref|NP_179884.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana] gi|75099209|sp|O64811.1|SCP9_ARATH RecName: Full=Serine carboxypeptidase-like 9; Flags: Precursor gi|3169175|gb|AAC17818.1| putative serine carboxypeptidase I [Arabidopsis thaliana] gi|330252303|gb|AEC07397.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana] Length = 437 Score = 80.5 bits (197), Expect = 1e-13 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = -2 Query: 430 YSGDHDFVVPFQSTQAWIRELNYSIIDDWRPWIVEGQFAGYT 305 +SGDHD +PFQ+TQAWI+ LNYSIIDDWRPW+++GQ AGYT Sbjct: 357 FSGDHDITMPFQATQAWIKSLNYSIIDDWRPWMIKGQIAGYT 398