BLASTX nr result
ID: Cnidium21_contig00004256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00004256 (1951 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACI13684.1| putative REV HD-ZipIII [Malus x domestica] 75 5e-11 ref|XP_002328157.1| predicted protein [Populus trichocarpa] gi|6... 71 1e-09 ref|XP_002529946.1| DNA binding protein, putative [Ricinus commu... 69 5e-09 ref|XP_003539765.1| PREDICTED: homeobox-leucine zipper protein R... 68 1e-08 ref|XP_003539764.1| PREDICTED: homeobox-leucine zipper protein R... 68 1e-08 >gb|ACI13684.1| putative REV HD-ZipIII [Malus x domestica] Length = 845 Score = 75.5 bits (184), Expect = 5e-11 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -1 Query: 784 VQRVVMAISPSGTSPTAGPKLSPGAPEAQTLANWICQSHRYLHING 647 VQRV MAISPSG SP+ GPKLSPG+PEAQTLA+WICQS+ Y H+ G Sbjct: 672 VQRVAMAISPSGLSPSVGPKLSPGSPEAQTLAHWICQSYSY-HVGG 716 >ref|XP_002328157.1| predicted protein [Populus trichocarpa] gi|60327623|gb|AAX19051.1| class III HD-Zip protein 2 [Populus trichocarpa] gi|222837672|gb|EEE76037.1| predicted protein [Populus trichocarpa] Length = 844 Score = 70.9 bits (172), Expect = 1e-09 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -1 Query: 784 VQRVVMAISPSGTSPTAGPKLSPGAPEAQTLANWICQSHRYLHIN 650 VQRV MAISPSG SP GPKLS G+PEA TLA+WICQSHR + +N Sbjct: 666 VQRVAMAISPSGLSPVLGPKLSAGSPEALTLAHWICQSHRQVLLN 710 >ref|XP_002529946.1| DNA binding protein, putative [Ricinus communis] gi|223530576|gb|EEF32454.1| DNA binding protein, putative [Ricinus communis] Length = 842 Score = 68.9 bits (167), Expect = 5e-09 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 784 VQRVVMAISPSGTSPTAGPKLSPGAPEAQTLANWICQSHRY 662 VQRV MAISPSG P GPKLSPG+PEA TLA+WICQS+ Y Sbjct: 669 VQRVAMAISPSGLGPAVGPKLSPGSPEALTLAHWICQSYSY 709 >ref|XP_003539765.1| PREDICTED: homeobox-leucine zipper protein REVOLUTA-like isoform 2 [Glycine max] Length = 844 Score = 67.8 bits (164), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 784 VQRVVMAISPSGTSPTAGPKLSPGAPEAQTLANWICQSHRY 662 VQRV MAISPSG SP+ G KLSPG+PEA TLA+WICQS+ Y Sbjct: 667 VQRVAMAISPSGISPSVGAKLSPGSPEAVTLAHWICQSYSY 707 >ref|XP_003539764.1| PREDICTED: homeobox-leucine zipper protein REVOLUTA-like isoform 1 [Glycine max] Length = 845 Score = 67.8 bits (164), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 784 VQRVVMAISPSGTSPTAGPKLSPGAPEAQTLANWICQSHRY 662 VQRV MAISPSG SP+ G KLSPG+PEA TLA+WICQS+ Y Sbjct: 668 VQRVAMAISPSGISPSVGAKLSPGSPEAVTLAHWICQSYSY 708