BLASTX nr result
ID: Cnidium21_contig00004250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00004250 (525 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22653.3| unnamed protein product [Vitis vinifera] 57 1e-06 ref|XP_003533979.1| PREDICTED: glutaminyl-peptide cyclotransfera... 55 8e-06 >emb|CBI22653.3| unnamed protein product [Vitis vinifera] Length = 315 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -1 Query: 522 EKNRIFVTGKLWPKLYEIKLHPMKKEL-NGNIGDICMPKRF 403 EKNR+FVTGKLWPKLYEIK+HPMK+ +G I +C+ F Sbjct: 273 EKNRLFVTGKLWPKLYEIKVHPMKRRFQDGVIEQLCLRMPF 313 >ref|XP_003533979.1| PREDICTED: glutaminyl-peptide cyclotransferase-like [Glycine max] Length = 290 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/42 (57%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -1 Query: 522 EKNRIFVTGKLWPKLYEIKLHPMKKEL-NGNIGDICMPKRFV 400 E+ RIFVTGKLWPKLYEIK+ P+K+ + G I +C+P+ +V Sbjct: 235 EQKRIFVTGKLWPKLYEIKVSPIKEPIEEGTIEQLCLPEPYV 276