BLASTX nr result
ID: Cnidium21_contig00003633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00003633 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135611.1| PREDICTED: REF/SRPP-like protein At3g05500-l... 72 2e-16 gb|AAO66433.2| small rubber particle protein [Hevea brasiliensis] 71 2e-16 ref|XP_002283697.1| PREDICTED: stress-related protein-like [Viti... 75 5e-16 emb|CAN60820.1| hypothetical protein VITISV_033223 [Vitis vinifera] 75 5e-16 ref|XP_002330158.1| predicted protein [Populus trichocarpa] gi|1... 70 3e-15 >ref|XP_004135611.1| PREDICTED: REF/SRPP-like protein At3g05500-like [Cucumis sativus] gi|449517347|ref|XP_004165707.1| PREDICTED: REF/SRPP-like protein At3g05500-like [Cucumis sativus] Length = 242 Score = 71.6 bits (174), Expect(2) = 2e-16 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +1 Query: 4 AEQYAASTWHSLNQLPLFPRVAQVVVPTAAYCSEKYNETVQ 126 AEQ AAS WH LNQLP+FP VAQ ++PTAAYC+EKYNETV+ Sbjct: 165 AEQCAASAWHKLNQLPVFPTVAQAILPTAAYCTEKYNETVR 205 Score = 38.9 bits (89), Expect(2) = 2e-16 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = +2 Query: 215 VSSYLPLVPTEKIAKVFSGSNAQAE 289 VSSYLPLVPTE+IAKVFS + + E Sbjct: 214 VSSYLPLVPTERIAKVFSKNGVEME 238 >gb|AAO66433.2| small rubber particle protein [Hevea brasiliensis] Length = 170 Score = 70.9 bits (172), Expect(2) = 2e-16 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +1 Query: 4 AEQYAASTWHSLNQLPLFPRVAQVVVPTAAYCSEKYNETVQRT 132 AEQ A + W LNQLPLFP+VAQVVVPTAAYCSEKYN+TV T Sbjct: 92 AEQCAVTAWRRLNQLPLFPQVAQVVVPTAAYCSEKYNQTVLST 134 Score = 39.3 bits (90), Expect(2) = 2e-16 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = +2 Query: 215 VSSYLPLVPTEKIAKVFSGSNAQA 286 VSSYLPLVPTE+IAKVFS AQ+ Sbjct: 141 VSSYLPLVPTERIAKVFSDDVAQS 164 >ref|XP_002283697.1| PREDICTED: stress-related protein-like [Vitis vinifera] Length = 238 Score = 74.7 bits (182), Expect(2) = 5e-16 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +1 Query: 1 VAEQYAASTWHSLNQLPLFPRVAQVVVPTAAYCSEKYNETVQRT 132 VA+ YA S WHSLN+LPLFP+V QVVVPTAAYCSE+YN+TV T Sbjct: 165 VAQHYAVSAWHSLNRLPLFPQVVQVVVPTAAYCSERYNQTVLST 208 Score = 34.3 bits (77), Expect(2) = 5e-16 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = +2 Query: 215 VSSYLPLVPTEKIAKVFSGSNAQA 286 VS+YLPLVPTEKI KVF G+ Q+ Sbjct: 215 VSTYLPLVPTEKITKVF-GAEVQS 237 >emb|CAN60820.1| hypothetical protein VITISV_033223 [Vitis vinifera] Length = 235 Score = 74.7 bits (182), Expect(2) = 5e-16 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +1 Query: 1 VAEQYAASTWHSLNQLPLFPRVAQVVVPTAAYCSEKYNETVQRT 132 VA+ YA S WHSLN+LPLFP+V QVVVPTAAYCSE+YN+TV T Sbjct: 162 VAQHYAVSAWHSLNRLPLFPQVVQVVVPTAAYCSERYNQTVLST 205 Score = 34.3 bits (77), Expect(2) = 5e-16 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = +2 Query: 215 VSSYLPLVPTEKIAKVFSGSNAQA 286 VS+YLPLVPTEKI KVF G+ Q+ Sbjct: 212 VSTYLPLVPTEKITKVF-GAEVQS 234 >ref|XP_002330158.1| predicted protein [Populus trichocarpa] gi|118483115|gb|ABK93466.1| unknown [Populus trichocarpa] gi|222871614|gb|EEF08745.1| predicted protein [Populus trichocarpa] Length = 242 Score = 70.5 bits (171), Expect(2) = 3e-15 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 4 AEQYAASTWHSLNQLPLFPRVAQVVVPTAAYCSEKYNETVQRT 132 AEQ A S W LNQLPLFP+VAQVVVPTAA+CSEKYN+T+ T Sbjct: 164 AEQAAVSAWRKLNQLPLFPQVAQVVVPTAAFCSEKYNQTILST 206 Score = 35.8 bits (81), Expect(2) = 3e-15 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +2 Query: 215 VSSYLPLVPTEKIAKVFS 268 VS YLPLVPTEKIAKVFS Sbjct: 213 VSLYLPLVPTEKIAKVFS 230