BLASTX nr result
ID: Cnidium21_contig00003190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00003190 (575 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313822.1| predicted protein [Populus trichocarpa] gi|1... 84 2e-14 ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 83 3e-14 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 82 6e-14 ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|1... 80 2e-13 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 77 2e-12 >ref|XP_002313822.1| predicted protein [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| predicted protein [Populus trichocarpa] Length = 54 Score = 83.6 bits (205), Expect = 2e-14 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -1 Query: 485 MFPGMY-QKPDKKAALKQLRVHGAMFGAWVVAIRVTPYILHYFSHQKQELSLDF 327 MFPG++ +KPDK ALKQLR H AMFGAWVV +RVTPY+LHY SH+K EL L+F Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPYVLHYISHEKDELKLEF 54 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = -1 Query: 485 MFPGMY-QKPDKKAALKQLRVHGAMFGAWVVAIRVTPYILHYFSHQKQELSLDF 327 MFPGM+ +KPDK AALKQLR H AMFG WV IRVTPY+LHY S +K+EL LDF Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLDF 54 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 82.0 bits (201), Expect = 6e-14 Identities = 38/54 (70%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = -1 Query: 485 MFPGMY-QKPDKKAALKQLRVHGAMFGAWVVAIRVTPYILHYFSHQKQELSLDF 327 MFPGM+ +KPDK AALKQL+ H A+FGAWV IRVTPY+LHY S K EL LDF Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYLSDDKDELKLDF 54 >ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| predicted protein [Populus trichocarpa] Length = 54 Score = 80.1 bits (196), Expect = 2e-13 Identities = 37/54 (68%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = -1 Query: 485 MFPGMY-QKPDKKAALKQLRVHGAMFGAWVVAIRVTPYILHYFSHQKQELSLDF 327 MFPGM+ +KPDK ALKQL+ H AMFGAWVV +RVTPY+LHY S +K EL L+F Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYLSDEKDELKLEF 54 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|356545339|ref|XP_003541101.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 2 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -1 Query: 485 MFPGMY-QKPDKKAALKQLRVHGAMFGAWVVAIRVTPYILHYFSHQKQELSLD 330 MFPGM+ +KPDK AALKQL+ H AMFG WVV IRVTPY+LH+ +K+EL L+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLHFLCAEKEELKLE 53