BLASTX nr result
ID: Cnidium21_contig00002967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00002967 (490 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW77571.1| AP2-domain DNA-binding protein ORCA3 [Catharanthu... 58 7e-07 gb|ABU40945.1| AP2-domain DNA-binding protein [Datura metel] 58 7e-07 emb|CAB96899.1| AP2-domain DNA-binding protein [Catharanthus ros... 58 7e-07 gb|AAM65925.1| putative ethylene response element binding protei... 58 9e-07 ref|NP_182011.1| ethylene-responsive transcription factor 13 [Ar... 58 9e-07 >gb|ABW77571.1| AP2-domain DNA-binding protein ORCA3 [Catharanthus roseus] Length = 200 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 488 ALAYDRAAFKIHGSAAKLNFPHLIGSNLPDPVKVAPRQR 372 ALAYD AAF + G+ A+LNFPHLIGSN+ PV+V PR+R Sbjct: 137 ALAYDAAAFNMRGAKARLNFPHLIGSNISGPVRVNPRKR 175 >gb|ABU40945.1| AP2-domain DNA-binding protein [Datura metel] Length = 203 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 488 ALAYDRAAFKIHGSAAKLNFPHLIGSNLPDPVKVAPRQR 372 ALAYD AAF + G+ A+LNFPHLIGSN+ PV+V PR+R Sbjct: 137 ALAYDAAAFNMRGAKARLNFPHLIGSNISGPVRVNPRKR 175 >emb|CAB96899.1| AP2-domain DNA-binding protein [Catharanthus roseus] gi|8980315|emb|CAB96900.1| AP2-domain DNA-binding protein [Catharanthus roseus] Length = 203 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 488 ALAYDRAAFKIHGSAAKLNFPHLIGSNLPDPVKVAPRQR 372 ALAYD AAF + G+ A+LNFPHLIGSN+ PV+V PR+R Sbjct: 137 ALAYDAAAFNMRGAKARLNFPHLIGSNISGPVRVNPRKR 175 >gb|AAM65925.1| putative ethylene response element binding protein (EREBP) [Arabidopsis thaliana] Length = 226 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -3 Query: 488 ALAYDRAAFKIHGSAAKLNFPHLIGSNLPDPVKVAPRQR 372 A+AYDRAAF++ GS AKLNFPHLIGS +PV++ PR+R Sbjct: 129 AVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPVRIRPRRR 167 >ref|NP_182011.1| ethylene-responsive transcription factor 13 [Arabidopsis thaliana] gi|57012834|sp|Q8L9K1.2|ERF99_ARATH RecName: Full=Ethylene-responsive transcription factor 13; Short=AtERF13; AltName: Full=Ethylene-responsive element-binding factor 13; Short=EREBP-13 gi|13272437|gb|AAK17157.1|AF325089_1 putative ethylene response element binding protein (EREBP) [Arabidopsis thaliana] gi|13899091|gb|AAK48967.1|AF370540_1 putative ethylene response element binding protein; EREBP [Arabidopsis thaliana] gi|2344900|gb|AAC31840.1| putative ethylene response element binding protein (EREBP) [Arabidopsis thaliana] gi|18377440|gb|AAL66886.1| putative ethylene response element binding protein (EREBP) [Arabidopsis thaliana] gi|330255379|gb|AEC10473.1| ethylene-responsive transcription factor 13 [Arabidopsis thaliana] Length = 226 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -3 Query: 488 ALAYDRAAFKIHGSAAKLNFPHLIGSNLPDPVKVAPRQR 372 A+AYDRAAF++ GS AKLNFPHLIGS +PV++ PR+R Sbjct: 129 AVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPVRIRPRRR 167