BLASTX nr result
ID: Cnidium21_contig00002899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00002899 (584 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265527.2| PREDICTED: choline/ethanolamine kinase [Viti... 106 3e-21 emb|CBI35067.3| unnamed protein product [Vitis vinifera] 106 3e-21 ref|XP_002525542.1| choline/ethanolamine kinase, putative [Ricin... 105 7e-21 ref|XP_004142378.1| PREDICTED: ethanolamine kinase 2-like [Cucum... 99 7e-19 gb|ABK94958.1| unknown [Populus trichocarpa] 98 9e-19 >ref|XP_002265527.2| PREDICTED: choline/ethanolamine kinase [Vitis vinifera] Length = 363 Score = 106 bits (264), Expect = 3e-21 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = -3 Query: 582 LVQEVEKYTLASHLFWGLWGLISELVNEIDFNYMEYARQRFQQYWFRKPELLGFS 418 LVQ+VEKYTLASHL WGLWG+ISE VNEIDFNYMEYARQRF+QYW RKPELLG S Sbjct: 291 LVQDVEKYTLASHLLWGLWGIISEHVNEIDFNYMEYARQRFEQYWLRKPELLGSS 345 >emb|CBI35067.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 106 bits (264), Expect = 3e-21 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = -3 Query: 582 LVQEVEKYTLASHLFWGLWGLISELVNEIDFNYMEYARQRFQQYWFRKPELLGFS 418 LVQ+VEKYTLASHL WGLWG+ISE VNEIDFNYMEYARQRF+QYW RKPELLG S Sbjct: 391 LVQDVEKYTLASHLLWGLWGIISEHVNEIDFNYMEYARQRFEQYWLRKPELLGSS 445 >ref|XP_002525542.1| choline/ethanolamine kinase, putative [Ricinus communis] gi|223535121|gb|EEF36801.1| choline/ethanolamine kinase, putative [Ricinus communis] Length = 332 Score = 105 bits (261), Expect = 7e-21 Identities = 49/60 (81%), Positives = 55/60 (91%) Frame = -3 Query: 582 LVQEVEKYTLASHLFWGLWGLISELVNEIDFNYMEYARQRFQQYWFRKPELLGFSTGSGT 403 L+++VEKYTLASHLFWGLWG+ISE VNEIDF+YMEYARQRF+QYW RKPELLG S GS T Sbjct: 274 LLEDVEKYTLASHLFWGLWGIISEHVNEIDFDYMEYARQRFEQYWLRKPELLG-SLGSHT 332 >ref|XP_004142378.1| PREDICTED: ethanolamine kinase 2-like [Cucumis sativus] Length = 350 Score = 98.6 bits (244), Expect = 7e-19 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -3 Query: 582 LVQEVEKYTLASHLFWGLWGLISELVNEIDFNYMEYARQRFQQYWFRKPELLG 424 LVQ+VEKYTLASHL WGLWG+ISE VN+IDF+Y+EYARQRF+QYW RKP+LLG Sbjct: 291 LVQDVEKYTLASHLVWGLWGIISEHVNDIDFDYIEYARQRFEQYWSRKPDLLG 343 >gb|ABK94958.1| unknown [Populus trichocarpa] Length = 359 Score = 98.2 bits (243), Expect = 9e-19 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -3 Query: 582 LVQEVEKYTLASHLFWGLWGLISELVNEIDFNYMEYARQRFQQYWFRKPELLG 424 L++ VEKY LASHLFWGLWG+ISE VNEIDF+YMEYARQRF+QYW RKP LLG Sbjct: 290 LLENVEKYKLASHLFWGLWGIISEHVNEIDFDYMEYARQRFEQYWLRKPALLG 342