BLASTX nr result
ID: Cnidium21_contig00002788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00002788 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519002.1| phosphoribulose kinase, putative [Ricinus co... 59 5e-07 ref|XP_002303455.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 >ref|XP_002519002.1| phosphoribulose kinase, putative [Ricinus communis] gi|223541989|gb|EEF43535.1| phosphoribulose kinase, putative [Ricinus communis] Length = 403 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 218 MAVCTAYNVKSLNSNYSISTPAKSHLGFHQKQVFFYS 328 MA+CT Y +SLNS SISTP K+HLGF+QKQV FYS Sbjct: 1 MAICTVYTTQSLNSTCSISTPGKTHLGFNQKQVVFYS 37 >ref|XP_002303455.1| predicted protein [Populus trichocarpa] gi|222840887|gb|EEE78434.1| predicted protein [Populus trichocarpa] Length = 405 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +2 Query: 218 MAVCTAYNVKSLNSNYSISTPAKSHLGFHQKQVFFYST 331 MAVCT Y +SLNS SISTP K+HLGF+Q+ V FYST Sbjct: 1 MAVCTVYTTQSLNSTCSISTPTKTHLGFNQRHVVFYST 38