BLASTX nr result
ID: Cnidium21_contig00002732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00002732 (486 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF15448.1| dehydrin 1 [Cichorium intybus] 62 5e-08 >gb|ACF15448.1| dehydrin 1 [Cichorium intybus] Length = 262 Score = 62.0 bits (149), Expect = 5e-08 Identities = 42/89 (47%), Positives = 48/89 (53%), Gaps = 6/89 (6%) Frame = -3 Query: 250 EKIKDKLPGGVKKEEEGPVAPTPAEY---DTVEGGEKGIMEKIKDKLPGDGHKXXXXXXX 80 EKIK+KLPGG KK EE AP P T EG +KG MEKIK+KLPG GHK Sbjct: 153 EKIKEKLPGGTKKAEEEHAAPPPPPAVVAHTEEGEQKGFMEKIKEKLPG-GHKKVEEEHA 211 Query: 79 XXXXPLDHSPNVVV---EGDEPAKKGIME 2 P VV +G++ KKGI E Sbjct: 212 TPPP----PPAVVAHADDGEQKEKKGIFE 236