BLASTX nr result
ID: Cnidium21_contig00002698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00002698 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_190187.1| actin depolymerizing factor 1 [Arabidopsis thal... 64 1e-08 ref|XP_002877449.1| hypothetical protein ARALYDRAFT_484981 [Arab... 64 1e-08 gb|ABX79380.1| actin-depolymerizing factor [Gossypium barbadense] 64 1e-08 ref|NP_001078247.1| actin depolymerizing factor 1 [Arabidopsis t... 64 1e-08 gb|ABD66504.1| actin depolymerizing factor 8 [Gossypium hirsutum... 64 1e-08 >ref|NP_190187.1| actin depolymerizing factor 1 [Arabidopsis thaliana] gi|17366511|sp|Q39250.1|ADF1_ARATH RecName: Full=Actin-depolymerizing factor 1; Short=ADF-1; Short=AtADF1 gi|11513711|pdb|1F7S|A Chain A, Crystal Structure Of Adf1 From Arabidopsis Thaliana gi|1408471|gb|AAB03696.1| actin depolymerizing factor 1 [Arabidopsis thaliana] gi|3851707|gb|AAC72407.1| actin depolymerizing factor 1 [Arabidopsis thaliana] gi|7630029|emb|CAB88325.1| actin depolymerizing factor 1 (ADF1) [Arabidopsis thaliana] gi|14334962|gb|AAK59658.1| putative actin depolymerizing factor ADF1 [Arabidopsis thaliana] gi|17065584|gb|AAL33770.1| putative actin depolymerizing factor 1 [Arabidopsis thaliana] gi|21553985|gb|AAM63066.1| actin-depolymerizing factor ADF-1 (AtADF1) [Arabidopsis thaliana] gi|195604826|gb|ACG24243.1| hypothetical protein [Zea mays] gi|332644579|gb|AEE78100.1| actin depolymerizing factor 1 [Arabidopsis thaliana] Length = 139 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 412 DRFKRELDGIQVELQATDPTEMDIDVIRSRAN 317 DRFKRELDGIQVELQATDPTEMD+DV RSRAN Sbjct: 108 DRFKRELDGIQVELQATDPTEMDLDVFRSRAN 139 >ref|XP_002877449.1| hypothetical protein ARALYDRAFT_484981 [Arabidopsis lyrata subsp. lyrata] gi|297323287|gb|EFH53708.1| hypothetical protein ARALYDRAFT_484981 [Arabidopsis lyrata subsp. lyrata] Length = 128 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 412 DRFKRELDGIQVELQATDPTEMDIDVIRSRAN 317 DRFKRELDGIQVELQATDPTEMD+DV RSRAN Sbjct: 97 DRFKRELDGIQVELQATDPTEMDLDVFRSRAN 128 >gb|ABX79380.1| actin-depolymerizing factor [Gossypium barbadense] Length = 139 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 412 DRFKRELDGIQVELQATDPTEMDIDVIRSRAN 317 DRFKRELDGIQVELQATDP+EMD+DVIRSRAN Sbjct: 108 DRFKRELDGIQVELQATDPSEMDLDVIRSRAN 139 >ref|NP_001078247.1| actin depolymerizing factor 1 [Arabidopsis thaliana] gi|332644580|gb|AEE78101.1| actin depolymerizing factor 1 [Arabidopsis thaliana] Length = 150 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 412 DRFKRELDGIQVELQATDPTEMDIDVIRSRAN 317 DRFKRELDGIQVELQATDPTEMD+DV RSRAN Sbjct: 119 DRFKRELDGIQVELQATDPTEMDLDVFRSRAN 150 >gb|ABD66504.1| actin depolymerizing factor 8 [Gossypium hirsutum] gi|119388970|gb|AAY88048.2| actin depolymerizing factor [Gossypium hirsutum] Length = 139 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 412 DRFKRELDGIQVELQATDPTEMDIDVIRSRAN 317 DRFKRELDGIQVELQATDP+EMD+DVIRSRAN Sbjct: 108 DRFKRELDGIQVELQATDPSEMDLDVIRSRAN 139