BLASTX nr result
ID: Cnidium21_contig00002565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00002565 (680 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528154.1| conserved hypothetical protein [Ricinus comm... 106 5e-21 >ref|XP_002528154.1| conserved hypothetical protein [Ricinus communis] gi|223532452|gb|EEF34245.1| conserved hypothetical protein [Ricinus communis] Length = 194 Score = 106 bits (264), Expect = 5e-21 Identities = 49/108 (45%), Positives = 70/108 (64%) Frame = -2 Query: 547 NGGYQKVATIFPFGAFAYWEAECFQHNNAYLTYTQDHGLGYVVLHAEDSKSWGCTDYYEF 368 NGGY+ V T++PF ++ ECFQ N AYL + VV+ A +KSW CTDYYEF Sbjct: 49 NGGYEYVGTVYPFNDRIHFRGECFQQNTAYLKESPYSLWNRVVIEARSAKSWACTDYYEF 108 Query: 367 KVEDQTIATESVFQGILSHEVAFDSQDRELRRKIRSVGVSIYVWSSNG 224 KV DQ++ T+S+ G+LS + + D+EL +IR+ GV+IY++ NG Sbjct: 109 KVGDQSLGTKSISIGLLSRDFEIYNLDKELWERIRAQGVAIYIYRENG 156