BLASTX nr result
ID: Cnidium21_contig00002523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00002523 (588 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002262911.1| PREDICTED: small ubiquitin-related modifier ... 174 1e-41 emb|CAN79327.1| hypothetical protein VITISV_032072 [Vitis vinifera] 174 1e-41 ref|XP_002271938.1| PREDICTED: small ubiquitin-related modifier ... 174 1e-41 ref|XP_002321284.1| predicted protein [Populus trichocarpa] gi|1... 174 1e-41 ref|XP_002521079.1| conserved hypothetical protein [Ricinus comm... 173 2e-41 >ref|XP_002262911.1| PREDICTED: small ubiquitin-related modifier 2 [Vitis vinifera] gi|296090483|emb|CBI40814.3| unnamed protein product [Vitis vinifera] Length = 103 Score = 174 bits (441), Expect = 1e-41 Identities = 90/101 (89%), Positives = 93/101 (92%), Gaps = 2/101 (1%) Frame = -1 Query: 585 MSATAGSEGGVGQEEEKKPMDQ--HINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQS 412 MSAT G+ GG QEE+KKP DQ HINLKVKGQDGNEVFFRIKRSTQLRKLM+AYCDRQS Sbjct: 1 MSATGGAAGG--QEEDKKPTDQGAHINLKVKGQDGNEVFFRIKRSTQLRKLMSAYCDRQS 58 Query: 411 VELNSIAFLFDGRRLRTEQTPDELEMEDGDEIDAMLHQTGG 289 VELNSIAFLFDGRRLR EQTPDELEMEDGDEIDAMLHQTGG Sbjct: 59 VELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 99 >emb|CAN79327.1| hypothetical protein VITISV_032072 [Vitis vinifera] Length = 104 Score = 174 bits (441), Expect = 1e-41 Identities = 90/101 (89%), Positives = 93/101 (92%), Gaps = 2/101 (1%) Frame = -1 Query: 585 MSATAGSEGGVGQEEEKKPMDQ--HINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQS 412 MSAT G+ GG QEE+KKP DQ HINLKVKGQDGNEVFFRIKRSTQLRKLM+AYCDRQS Sbjct: 1 MSATGGAAGG--QEEDKKPTDQGAHINLKVKGQDGNEVFFRIKRSTQLRKLMSAYCDRQS 58 Query: 411 VELNSIAFLFDGRRLRTEQTPDELEMEDGDEIDAMLHQTGG 289 VELNSIAFLFDGRRLR EQTPDELEMEDGDEIDAMLHQTGG Sbjct: 59 VELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 99 >ref|XP_002271938.1| PREDICTED: small ubiquitin-related modifier 2 isoform 1 [Vitis vinifera] gi|147785046|emb|CAN71030.1| hypothetical protein VITISV_013543 [Vitis vinifera] Length = 114 Score = 174 bits (441), Expect = 1e-41 Identities = 92/112 (82%), Positives = 95/112 (84%), Gaps = 6/112 (5%) Frame = -1 Query: 585 MSATAGSEGGV----GQEEEKKPMDQ--HINLKVKGQDGNEVFFRIKRSTQLRKLMTAYC 424 MSAT G G GQEE+KKPMDQ HINLKVKGQDGNEVFFRIKRSTQLRKLM+AYC Sbjct: 1 MSATGGVAGAGAGTGGQEEDKKPMDQGAHINLKVKGQDGNEVFFRIKRSTQLRKLMSAYC 60 Query: 423 DRQSVELNSIAFLFDGRRLRTEQTPDELEMEDGDEIDAMLHQTGGCVTLTAT 268 DRQSVELNSIAFLFDGRRLR EQTPDELEMEDGDEIDAMLHQTGG + T Sbjct: 61 DRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGVAWMCLT 112 >ref|XP_002321284.1| predicted protein [Populus trichocarpa] gi|118487404|gb|ABK95530.1| unknown [Populus trichocarpa] gi|222862057|gb|EEE99599.1| predicted protein [Populus trichocarpa] Length = 108 Score = 174 bits (440), Expect = 1e-41 Identities = 88/102 (86%), Positives = 91/102 (89%), Gaps = 3/102 (2%) Frame = -1 Query: 585 MSATAGSEGGVGQEEEKKP---MDQHINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQ 415 MSA+AG GG GQEE+KKP HINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQ Sbjct: 1 MSASAGGGGGGGQEEDKKPGGDQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQ 60 Query: 414 SVELNSIAFLFDGRRLRTEQTPDELEMEDGDEIDAMLHQTGG 289 SVE NSIAFLFDGRRLR EQTPDEL+MEDGDEIDAMLHQTGG Sbjct: 61 SVEFNSIAFLFDGRRLRGEQTPDELDMEDGDEIDAMLHQTGG 102 >ref|XP_002521079.1| conserved hypothetical protein [Ricinus communis] gi|223539648|gb|EEF41230.1| conserved hypothetical protein [Ricinus communis] Length = 108 Score = 173 bits (439), Expect = 2e-41 Identities = 90/103 (87%), Positives = 93/103 (90%), Gaps = 4/103 (3%) Frame = -1 Query: 585 MSATAGS--EGGVGQEEEKKPMDQ--HINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDR 418 MSAT GS G GQEE+KKPMDQ HINLKVKGQDGNE+FFRIKRSTQLRKL+TAYCDR Sbjct: 1 MSATPGSGGAGAGGQEEDKKPMDQTAHINLKVKGQDGNEMFFRIKRSTQLRKLITAYCDR 60 Query: 417 QSVELNSIAFLFDGRRLRTEQTPDELEMEDGDEIDAMLHQTGG 289 QSVE NSIAFLFDGRRLR EQTPDELEMEDGDEIDAMLHQTGG Sbjct: 61 QSVEFNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 103