BLASTX nr result
ID: Cnidium21_contig00002506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00002506 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138385.1| PREDICTED: peroxiredoxin Q, chloroplastic-li... 90 2e-16 ref|XP_002275936.1| PREDICTED: peroxiredoxin Q, chloroplastic [V... 90 2e-16 sp|Q9MB35.1|PERQ_SEDLI RecName: Full=Peroxiredoxin Q, chloroplas... 89 3e-16 ref|XP_002326305.1| peroxiredoxin [Populus trichocarpa] gi|22283... 89 4e-16 sp|Q6QPJ6.1|PRXQ_POPJC RecName: Full=Peroxiredoxin Q, chloroplas... 89 4e-16 >ref|XP_004138385.1| PREDICTED: peroxiredoxin Q, chloroplastic-like [Cucumis sativus] gi|449499188|ref|XP_004160744.1| PREDICTED: peroxiredoxin Q, chloroplastic-like [Cucumis sativus] Length = 215 Score = 89.7 bits (221), Expect = 2e-16 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 388 LPFTLLSDEGNKVRKDWGVPSDLFGTLPGRQTYVLDKSGKVQLIY 254 LPFTLLSDEGNKVRK+WGVP+DLFGTLPGRQTYVLDK+G VQLIY Sbjct: 151 LPFTLLSDEGNKVRKEWGVPADLFGTLPGRQTYVLDKNGVVQLIY 195 >ref|XP_002275936.1| PREDICTED: peroxiredoxin Q, chloroplastic [Vitis vinifera] gi|297738519|emb|CBI27764.3| unnamed protein product [Vitis vinifera] gi|342160856|gb|AEL16464.1| peroxiredoxin Q [Vitis vinifera] Length = 214 Score = 89.7 bits (221), Expect = 2e-16 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 388 LPFTLLSDEGNKVRKDWGVPSDLFGTLPGRQTYVLDKSGKVQLIY 254 LPFTLLSD+GNKVRKDWGVP+DLFGTLPGRQTYVLDK G VQLIY Sbjct: 150 LPFTLLSDDGNKVRKDWGVPADLFGTLPGRQTYVLDKKGVVQLIY 194 >sp|Q9MB35.1|PERQ_SEDLI RecName: Full=Peroxiredoxin Q, chloroplastic; AltName: Full=Thioredoxin reductase; Flags: Precursor gi|6899842|dbj|BAA90524.1| peroxiredoxin Q [Sedum lineare] Length = 186 Score = 89.4 bits (220), Expect = 3e-16 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -3 Query: 388 LPFTLLSDEGNKVRKDWGVPSDLFGTLPGRQTYVLDKSGKVQLIY 254 LPFTLLSDEGNKVRK+WGVPSDLFGTLPGR+TYVLDK+G VQL+Y Sbjct: 121 LPFTLLSDEGNKVRKEWGVPSDLFGTLPGRETYVLDKNGVVQLVY 165 >ref|XP_002326305.1| peroxiredoxin [Populus trichocarpa] gi|222833498|gb|EEE71975.1| peroxiredoxin [Populus trichocarpa] Length = 214 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 388 LPFTLLSDEGNKVRKDWGVPSDLFGTLPGRQTYVLDKSGKVQLIY 254 LPFTLLSDEGNK+RK+WGVP+DLFGTLPGRQTYVLDK G VQLIY Sbjct: 150 LPFTLLSDEGNKIRKEWGVPADLFGTLPGRQTYVLDKKGVVQLIY 194 >sp|Q6QPJ6.1|PRXQ_POPJC RecName: Full=Peroxiredoxin Q, chloroplastic; AltName: Full=Thioredoxin reductase; Flags: Precursor gi|42795441|gb|AAS46230.1| peroxiredoxin Q [Populus trichocarpa x Populus deltoides] gi|118489762|gb|ABK96681.1| unknown [Populus trichocarpa x Populus deltoides] Length = 213 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 388 LPFTLLSDEGNKVRKDWGVPSDLFGTLPGRQTYVLDKSGKVQLIY 254 LPFTLLSDEGNK+RK+WGVP+DLFGTLPGRQTYVLDK G VQLIY Sbjct: 149 LPFTLLSDEGNKIRKEWGVPADLFGTLPGRQTYVLDKKGVVQLIY 193