BLASTX nr result
ID: Cnidium21_contig00002446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00002446 (1761 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 62 6e-07 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 61.6 bits (148), Expect = 6e-07 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +3 Query: 1455 ILWLAHSKXXXXXXXXXXXXEFLAPKVEGTALGWLHRAAITSLSCRWKDNMPVL 1616 ++WLA SK + P+ EGTALGW HRAAITSLS +WKDN PVL Sbjct: 1 MIWLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPVL 54