BLASTX nr result
ID: Cnidium21_contig00002134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00002134 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEJ72566.1| putative CC-NBS-LRR protein [Malus x domestica] 58 7e-07 ref|XP_002524237.1| Disease resistance protein RPP8, putative [R... 57 2e-06 gb|ABG00915.1| disease resistance protein [Arabidopsis thaliana] 56 3e-06 gb|ABG00923.1| disease resistance protein [Arabidopsis thaliana] 56 3e-06 ref|XP_002888196.1| hypothetical protein ARALYDRAFT_475351 [Arab... 56 4e-06 >gb|AEJ72566.1| putative CC-NBS-LRR protein [Malus x domestica] Length = 968 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = +1 Query: 205 ITRLTLWKSCLKEDPMPFLEKIATLRDLSLHNTFVGKEMICSATGFPK 348 + +LTLW S L+EDPMP LE++ LR LS F GK+M+CS GFPK Sbjct: 838 LAKLTLWGSNLEEDPMPTLERLPNLRILSGWQMFAGKKMVCSNQGFPK 885 >ref|XP_002524237.1| Disease resistance protein RPP8, putative [Ricinus communis] gi|223536514|gb|EEF38161.1| Disease resistance protein RPP8, putative [Ricinus communis] Length = 857 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = +1 Query: 205 ITRLTLWKSCLKEDPMPFLEKIATLRDLSLHNTFVGKEMICSATGFPK 348 + +LTL +S L++DPMP LEK+ LR LSL T+ G M+CSA GFP+ Sbjct: 721 LAKLTLCRSQLRQDPMPILEKLPNLRFLSLEGTYKGPVMVCSAYGFPQ 768 >gb|ABG00915.1| disease resistance protein [Arabidopsis thaliana] Length = 343 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +1 Query: 205 ITRLTLWKSCLKEDPMPFLEKIATLRDLSL-HNTFVGKEMICSATGFPK 348 + ++L + CLKEDPMP LEK+ L ++SL H +F GK M+CS GFP+ Sbjct: 211 LRNISLAECCLKEDPMPILEKLLQLNEVSLSHQSFCGKRMVCSVGGFPQ 259 >gb|ABG00923.1| disease resistance protein [Arabidopsis thaliana] Length = 343 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +1 Query: 205 ITRLTLWKSCLKEDPMPFLEKIATLRDLSL-HNTFVGKEMICSATGFPK 348 + ++L + CLKEDPMP LEK+ L ++SL H +F GK M+CS GFP+ Sbjct: 211 LRNISLAECCLKEDPMPILEKLLQLNEVSLSHQSFCGKRMVCSVGGFPQ 259 >ref|XP_002888196.1| hypothetical protein ARALYDRAFT_475351 [Arabidopsis lyrata subsp. lyrata] gi|297334037|gb|EFH64455.1| hypothetical protein ARALYDRAFT_475351 [Arabidopsis lyrata subsp. lyrata] Length = 790 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +1 Query: 205 ITRLTLWKSCLKEDPMPFLEKIATLRDLSL-HNTFVGKEMICSATGFPK 348 + ++L + CLKEDPMP LEK+ L ++SL H +F GK M+CS GFP+ Sbjct: 658 LRNISLAECCLKEDPMPILEKLIHLNEVSLSHQSFCGKRMVCSGGGFPQ 706