BLASTX nr result
ID: Cnidium21_contig00002080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00002080 (1234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA76346.1| putative arginine/serine-rich splicing factor [M... 82 1e-30 gb|AFK48021.1| unknown [Medicago truncatula] 82 1e-30 gb|ACJ85259.1| unknown [Medicago truncatula] 82 1e-30 gb|ABK94120.1| unknown [Populus trichocarpa] 83 2e-30 ref|XP_003615646.1| Splicing factor, arginine/serine-rich [Medic... 83 2e-30 >emb|CAA76346.1| putative arginine/serine-rich splicing factor [Medicago sativa subsp. x varia] Length = 286 Score = 82.0 bits (201), Expect(2) = 1e-30 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 FRTSADDLFPLFDKYGKVVDIFIPRDRRTGESRGFGFVRY 120 FRT+ADDLFPLFDKYGKVVDIFIP+DRRTGESRGF FVRY Sbjct: 25 FRTTADDLFPLFDKYGKVVDIFIPKDRRTGESRGFAFVRY 64 Score = 78.6 bits (192), Expect(2) = 1e-30 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 216 YAEEAQEAVDKLDGRTVDGREITVQFAKYGPNAERIQQGRIIE 344 YA+EA +AVD+LDGR VDGREITVQFAKYGPNAERIQ+GRIIE Sbjct: 66 YADEASKAVDRLDGRMVDGREITVQFAKYGPNAERIQKGRIIE 108 >gb|AFK48021.1| unknown [Medicago truncatula] Length = 281 Score = 82.0 bits (201), Expect(2) = 1e-30 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 FRTSADDLFPLFDKYGKVVDIFIPRDRRTGESRGFGFVRY 120 FRT+ADDLFPLFDKYGKVVDIFIP+DRRTGESRGF FVRY Sbjct: 25 FRTTADDLFPLFDKYGKVVDIFIPKDRRTGESRGFAFVRY 64 Score = 78.6 bits (192), Expect(2) = 1e-30 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 216 YAEEAQEAVDKLDGRTVDGREITVQFAKYGPNAERIQQGRIIE 344 YA+EA +AVD+LDGR VDGREITVQFAKYGPNAERIQ+GRIIE Sbjct: 66 YADEASKAVDRLDGRMVDGREITVQFAKYGPNAERIQKGRIIE 108 >gb|ACJ85259.1| unknown [Medicago truncatula] Length = 280 Score = 82.0 bits (201), Expect(2) = 1e-30 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 FRTSADDLFPLFDKYGKVVDIFIPRDRRTGESRGFGFVRY 120 FRT+ADDLFPLFDKYGKVVDIFIP+DRRTGESRGF FVRY Sbjct: 25 FRTTADDLFPLFDKYGKVVDIFIPKDRRTGESRGFAFVRY 64 Score = 78.6 bits (192), Expect(2) = 1e-30 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 216 YAEEAQEAVDKLDGRTVDGREITVQFAKYGPNAERIQQGRIIE 344 YA+EA +AVD+LDGR VDGREITVQFAKYGPNAERIQ+GRIIE Sbjct: 66 YADEASKAVDRLDGRMVDGREITVQFAKYGPNAERIQKGRIIE 108 >gb|ABK94120.1| unknown [Populus trichocarpa] Length = 302 Score = 82.8 bits (203), Expect(2) = 2e-30 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 FRTSADDLFPLFDKYGKVVDIFIPRDRRTGESRGFGFVRY 120 FRT+ADDLFPLFDKYGKVVD+FIPRDRRTGESRGF FVRY Sbjct: 25 FRTTADDLFPLFDKYGKVVDVFIPRDRRTGESRGFAFVRY 64 Score = 77.4 bits (189), Expect(2) = 2e-30 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +3 Query: 216 YAEEAQEAVDKLDGRTVDGREITVQFAKYGPNAERIQQGRIIE 344 YAEEAQ+AVD+LDGR VDGREI VQFAKYGPNAERI+ GRI+E Sbjct: 66 YAEEAQKAVDRLDGRVVDGREIMVQFAKYGPNAERIRSGRIVE 108 >ref|XP_003615646.1| Splicing factor, arginine/serine-rich [Medicago truncatula] gi|217073250|gb|ACJ84984.1| unknown [Medicago truncatula] gi|355516981|gb|AES98604.1| Splicing factor, arginine/serine-rich [Medicago truncatula] Length = 267 Score = 83.2 bits (204), Expect(2) = 2e-30 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 1 FRTSADDLFPLFDKYGKVVDIFIPRDRRTGESRGFGFVRY 120 FRT+ADDLFPLFDKYGKVVDIFIPRDRRTGESRGF FVRY Sbjct: 25 FRTTADDLFPLFDKYGKVVDIFIPRDRRTGESRGFAFVRY 64 Score = 76.6 bits (187), Expect(2) = 2e-30 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +3 Query: 216 YAEEAQEAVDKLDGRTVDGREITVQFAKYGPNAERIQQGRIIE 344 YA+EA +AVD+LDGR VDGREITVQFAKYGPNAERI +GRIIE Sbjct: 66 YADEASKAVDRLDGRMVDGREITVQFAKYGPNAERIHKGRIIE 108