BLASTX nr result
ID: Cnidium21_contig00001964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00001964 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK40884.1| unknown [Lotus japonicus] 92 4e-17 ref|XP_002520437.1| FUS-interacting serine-arginine-rich protein... 92 4e-17 gb|AFK47423.1| unknown [Medicago truncatula] 90 2e-16 ref|XP_003530834.1| PREDICTED: uncharacterized protein LOC100805... 90 2e-16 ref|XP_003551321.1| PREDICTED: uncharacterized protein LOC100808... 89 5e-16 >gb|AFK40884.1| unknown [Lotus japonicus] Length = 344 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = +3 Query: 219 EVENPGNNLYVTGLSPRITKRDIEKHFSTEGKVEDVHLVVDPWSRES 359 +VENPGNNLYVTGLSPRITKR++EKHF+TEGKV DVHLVVDPW+RES Sbjct: 42 DVENPGNNLYVTGLSPRITKRELEKHFATEGKVIDVHLVVDPWTRES 88 >ref|XP_002520437.1| FUS-interacting serine-arginine-rich protein 1, putative [Ricinus communis] gi|223540279|gb|EEF41850.1| FUS-interacting serine-arginine-rich protein 1, putative [Ricinus communis] Length = 399 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = +3 Query: 219 EVENPGNNLYVTGLSPRITKRDIEKHFSTEGKVEDVHLVVDPWSRES 359 +VENPGNNLYVTGLSPRITKRD+EKHF++EGKV DVHLVVDPW+RES Sbjct: 41 DVENPGNNLYVTGLSPRITKRDLEKHFASEGKVIDVHLVVDPWTRES 87 >gb|AFK47423.1| unknown [Medicago truncatula] Length = 340 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = +3 Query: 219 EVENPGNNLYVTGLSPRITKRDIEKHFSTEGKVEDVHLVVDPWSRES 359 +VENPGNNLYVTGLSPRITKR++EKHFS +GKV DVHLVVDPW+RES Sbjct: 39 DVENPGNNLYVTGLSPRITKRELEKHFSAKGKVVDVHLVVDPWTRES 85 >ref|XP_003530834.1| PREDICTED: uncharacterized protein LOC100805126 [Glycine max] Length = 362 Score = 89.7 bits (221), Expect = 2e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +3 Query: 219 EVENPGNNLYVTGLSPRITKRDIEKHFSTEGKVEDVHLVVDPWSRES 359 + ENPGNNLYVTGLSPRITKR++EKHFS EGKV DVHLVVDPW+RES Sbjct: 42 DAENPGNNLYVTGLSPRITKRELEKHFSAEGKVIDVHLVVDPWTRES 88 >ref|XP_003551321.1| PREDICTED: uncharacterized protein LOC100808038 [Glycine max] Length = 364 Score = 88.6 bits (218), Expect = 5e-16 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = +3 Query: 219 EVENPGNNLYVTGLSPRITKRDIEKHFSTEGKVEDVHLVVDPWSRES 359 + ENPGNNLYVTGLSPRITKR++EKHF+ EGKV DVHLVVDPW+RES Sbjct: 44 DAENPGNNLYVTGLSPRITKRELEKHFAAEGKVIDVHLVVDPWTRES 90