BLASTX nr result
ID: Cnidium21_contig00001025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00001025 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532897.1| ubiquitin-protein ligase, putative [Ricinus ... 69 2e-24 ref|XP_004136686.1| PREDICTED: probable ubiquitin conjugation fa... 70 6e-22 ref|XP_003633847.1| PREDICTED: probable ubiquitin conjugation fa... 68 2e-21 ref|XP_002324089.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-19 ref|NP_568313.2| putative ubiquitin conjugation factor E4 [Arabi... 65 1e-18 >ref|XP_002532897.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527331|gb|EEF29477.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 1031 Score = 69.3 bits (168), Expect(2) = 2e-24 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +3 Query: 3 LLKNTNTRENVLQYLAEVITKNKSRAHIQVDPISYVSSGMFV 128 LLKN +TRENVLQYLAEVI +N SRAHIQVDP+S SSGMFV Sbjct: 318 LLKNGDTRENVLQYLAEVINRNSSRAHIQVDPLSCASSGMFV 359 Score = 68.2 bits (165), Expect(2) = 2e-24 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = +2 Query: 161 LTALHAWSEEVA*WIIKNNHGKGDVNGTNNDGENRLLQSQEASSSGSNT 307 LTALHA SEEV W+ K NHGK +V+ ++DGENRLLQSQEA+SSGS T Sbjct: 399 LTALHASSEEVTEWMNKGNHGKTEVSVQSSDGENRLLQSQEATSSGSGT 447 >ref|XP_004136686.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Cucumis sativus] gi|449494681|ref|XP_004159617.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Cucumis sativus] Length = 1043 Score = 70.5 bits (171), Expect(2) = 6e-22 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +3 Query: 3 LLKNTNTRENVLQYLAEVITKNKSRAHIQVDPISYVSSGMFV 128 LLKNT TRENVL+YLAEVI +N SRAHIQVDP+S SSGMFV Sbjct: 323 LLKNTETRENVLEYLAEVINRNSSRAHIQVDPLSCASSGMFV 364 Score = 58.5 bits (140), Expect(2) = 6e-22 Identities = 34/58 (58%), Positives = 39/58 (67%), Gaps = 3/58 (5%) Frame = +2 Query: 140 CYAAPLEL---TALHAWSEEVA*WIIKNNHGKGDVNGTNNDGENRLLQSQEASSSGSN 304 CY+ LEL TALHA SEEV WI + D G ++D E+RLLQSQEASSSGSN Sbjct: 394 CYSNRLELRGLTALHASSEEVTEWINNGTQLRTDNPGQSSDSESRLLQSQEASSSGSN 451 >ref|XP_003633847.1| PREDICTED: probable ubiquitin conjugation factor E4-like [Vitis vinifera] gi|296082973|emb|CBI22274.3| unnamed protein product [Vitis vinifera] Length = 1037 Score = 67.8 bits (164), Expect(2) = 2e-21 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 3 LLKNTNTRENVLQYLAEVITKNKSRAHIQVDPISYVSSGMFV 128 LLKN +TRE+VL+YLAEVI KN SRAHIQVDP+S SSGMFV Sbjct: 317 LLKNADTRESVLKYLAEVINKNSSRAHIQVDPLSCASSGMFV 358 Score = 59.3 bits (142), Expect(2) = 2e-21 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = +2 Query: 161 LTALHAWSEEVA*WIIKNNHGKGDVNGTNNDGENRLLQSQEASSSGSNTGG 313 LTALHA SEEVA WI K++ G + + +DGE+RLLQSQEA+SSGSN G Sbjct: 396 LTALHASSEEVAEWINKDSPGGTEGSRQYSDGESRLLQSQEATSSGSNAHG 446 >ref|XP_002324089.1| predicted protein [Populus trichocarpa] gi|222867091|gb|EEF04222.1| predicted protein [Populus trichocarpa] Length = 1019 Score = 67.0 bits (162), Expect(2) = 1e-19 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 3 LLKNTNTRENVLQYLAEVITKNKSRAHIQVDPISYVSSGMFV 128 LLKN++TRE+VLQYLAEVI +N +RAHIQVDP+S SSGMFV Sbjct: 316 LLKNSDTRESVLQYLAEVINRNATRAHIQVDPLSCASSGMFV 357 Score = 54.3 bits (129), Expect(2) = 1e-19 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = +2 Query: 161 LTALHAWSEEVA*WIIKNNHGKGDVNGTNNDGENRLLQSQEASSSGSNTGGK 316 LTALHA SEE+ W+ N K DV+ ++D ENRLLQSQEASSSG N+G K Sbjct: 397 LTALHASSEEITEWL--NTPRKTDVSALSSDEENRLLQSQEASSSG-NSGEK 445 >ref|NP_568313.2| putative ubiquitin conjugation factor E4 [Arabidopsis thaliana] gi|75174048|sp|Q9LF41.1|UBE4_ARATH RecName: Full=Probable ubiquitin conjugation factor E4; AltName: Full=Plant U-box protein 1; AltName: Full=U-box domain-containing protein 1; AltName: Full=Ubiquitin-fusion degradation protein 2-like; Short=UB fusion protein 2-like gi|9755795|emb|CAC01739.1| ubiquitin-fusion degradation protein-like [Arabidopsis thaliana] gi|332004773|gb|AED92156.1| putative ubiquitin conjugation factor E4 [Arabidopsis thaliana] Length = 1038 Score = 65.1 bits (157), Expect(2) = 1e-18 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +3 Query: 3 LLKNTNTRENVLQYLAEVITKNKSRAHIQVDPISYVSSGMFV 128 LLK+T+TRE VLQ+LAEVI N SRAHIQVDP+S SSGMFV Sbjct: 327 LLKSTDTRERVLQFLAEVINANASRAHIQVDPVSCASSGMFV 368 Score = 52.8 bits (125), Expect(2) = 1e-18 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = +2 Query: 158 ELTALHAWSEEVA*WIIKNNHGKGDVNGTNNDGENRLLQSQEASSSGSNTGGK 316 +LTALHA SEEV WI K+ + G N E+RLLQS+EA+SS SN G+ Sbjct: 407 DLTALHASSEEVTEWIGKDAMANANDAGRENGNESRLLQSKEATSSSSNASGQ 459