BLASTX nr result
ID: Cnidium21_contig00000766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00000766 (815 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601839.1| Neurolysin [Medicago truncatula] gi|35549088... 41 8e-07 ref|XP_002514973.1| oligopeptidase, putative [Ricinus communis] ... 40 3e-06 ref|XP_002314557.1| predicted protein [Populus trichocarpa] gi|2... 39 5e-06 >ref|XP_003601839.1| Neurolysin [Medicago truncatula] gi|355490887|gb|AES72090.1| Neurolysin [Medicago truncatula] Length = 708 Score = 40.8 bits (94), Expect(2) = 8e-07 Identities = 30/86 (34%), Positives = 43/86 (50%) Frame = -2 Query: 736 FVVQTIVFYFIRPRPLQYLLGWLYLIDSSIIQLTIKCYMFLIQINTTSLFAGLRIEEIA* 557 F ++ +++Y R Y L + + I L + ++Q LF GLR EEIA Sbjct: 359 FGIEDLLYYVKRVEEQSYDLDFGEIKQYLPIGLVLSGIFKIVQ----DLF-GLRFEEIAG 413 Query: 556 SIVWNYDVNVY*NFDLRVCELFGYLY 479 + VW+ DV V+ FDL EL GY Y Sbjct: 414 AEVWHCDVRVFAVFDLSSSELLGYCY 439 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -3 Query: 483 CTTHLYRREGKYGHTCVVPLQRGS 412 C L+ REGKYGH+CVVPLQ + Sbjct: 438 CYLDLFSREGKYGHSCVVPLQNSA 461 >ref|XP_002514973.1| oligopeptidase, putative [Ricinus communis] gi|223546024|gb|EEF47527.1| oligopeptidase, putative [Ricinus communis] Length = 709 Score = 39.7 bits (91), Expect(2) = 3e-06 Identities = 19/28 (67%), Positives = 23/28 (82%), Gaps = 1/28 (3%) Frame = -3 Query: 471 LYRREGKYGHTCVVPLQRGS-SHDYARQ 391 L++REGKYGHTCVV LQ G+ S + ARQ Sbjct: 443 LFKREGKYGHTCVVALQNGALSSNGARQ 470 Score = 37.7 bits (86), Expect(2) = 3e-06 Identities = 27/86 (31%), Positives = 43/86 (50%) Frame = -2 Query: 736 FVVQTIVFYFIRPRPLQYLLGWLYLIDSSIIQLTIKCYMFLIQINTTSLFAGLRIEEIA* 557 F ++ +++Y R Q+ + + L + L + ++Q LF GLR +EI Sbjct: 360 FGIEDLLYYVKRVEEKQFDVDFGALKQYFPVDLVLSGIFKIVQ----DLF-GLRFQEIKD 414 Query: 556 SIVWNYDVNVY*NFDLRVCELFGYLY 479 + VW+ DV+V FDL EL GY Y Sbjct: 415 AEVWHSDVSVISVFDLSSAELLGYFY 440 >ref|XP_002314557.1| predicted protein [Populus trichocarpa] gi|222863597|gb|EEF00728.1| predicted protein [Populus trichocarpa] Length = 710 Score = 38.5 bits (88), Expect(2) = 5e-06 Identities = 21/41 (51%), Positives = 27/41 (65%) Frame = -2 Query: 601 TTSLFAGLRIEEIA*SIVWNYDVNVY*NFDLRVCELFGYLY 479 T LF GLR +E+A + VW+ DV+V+ FDL EL GY Y Sbjct: 402 TQDLF-GLRFQEVADAEVWHGDVSVFSVFDLSSGELLGYFY 441 Score = 38.1 bits (87), Expect(2) = 5e-06 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 471 LYRREGKYGHTCVVPLQRGS 412 +Y REGKYGHTCVV LQ G+ Sbjct: 444 IYMREGKYGHTCVVALQNGA 463