BLASTX nr result
ID: Cnidium21_contig00000086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00000086 (979 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002879453.1| 50S ribosomal protein L28, chloroplast [Arab... 147 5e-33 ref|NP_565765.1| 50S ribosomal protein L28 [Arabidopsis thaliana... 147 5e-33 sp|P30956.1|RK28_TOBAC RecName: Full=50S ribosomal protein L28, ... 147 5e-33 gb|AEC11026.1| 50S ribosomal protein L28 [Camellia sinensis] 145 1e-32 emb|CBI23685.3| unnamed protein product [Vitis vinifera] 145 1e-32 >ref|XP_002879453.1| 50S ribosomal protein L28, chloroplast [Arabidopsis lyrata subsp. lyrata] gi|297325292|gb|EFH55712.1| 50S ribosomal protein L28, chloroplast [Arabidopsis lyrata subsp. lyrata] Length = 143 Score = 147 bits (370), Expect = 5e-33 Identities = 70/75 (93%), Positives = 73/75 (97%) Frame = +3 Query: 570 RICPFTGKKANKANKVSHSNHKTKKLQFVNLQYKRIWWEAGNRFVKLRLSTKAIKTIEKN 749 RICPFTGKKAN+ANKVS SNHKTKKLQFVNLQYKR+WWEAG RFVKLRLSTKA+KTIEKN Sbjct: 68 RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRFVKLRLSTKALKTIEKN 127 Query: 750 GLDAVAKKAGIDLRK 794 GLDAVAKKAGIDLRK Sbjct: 128 GLDAVAKKAGIDLRK 142 >ref|NP_565765.1| 50S ribosomal protein L28 [Arabidopsis thaliana] gi|21542433|sp|O22795.2|RK28_ARATH RecName: Full=50S ribosomal protein L28, chloroplastic; AltName: Full=CL28; Flags: Precursor gi|18252877|gb|AAL62365.1| putative chloroplast 50S ribosomal protein L28 [Arabidopsis thaliana] gi|20196843|gb|AAB80662.2| putative chloroplast 50S ribosomal protein L28 [Arabidopsis thaliana] gi|21387067|gb|AAM47937.1| putative chloroplast 50S ribosomal protein L28 [Arabidopsis thaliana] gi|21592705|gb|AAM64654.1| putative chloroplast 50S ribosomal protein L28 [Arabidopsis thaliana] gi|330253742|gb|AEC08836.1| 50S ribosomal protein L28 [Arabidopsis thaliana] Length = 143 Score = 147 bits (370), Expect = 5e-33 Identities = 70/75 (93%), Positives = 73/75 (97%) Frame = +3 Query: 570 RICPFTGKKANKANKVSHSNHKTKKLQFVNLQYKRIWWEAGNRFVKLRLSTKAIKTIEKN 749 RICPFTGKKAN+ANKVS SNHKTKKLQFVNLQYKR+WWEAG RFVKLRLSTKA+KTIEKN Sbjct: 68 RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRFVKLRLSTKALKTIEKN 127 Query: 750 GLDAVAKKAGIDLRK 794 GLDAVAKKAGIDLRK Sbjct: 128 GLDAVAKKAGIDLRK 142 >sp|P30956.1|RK28_TOBAC RecName: Full=50S ribosomal protein L28, chloroplastic; AltName: Full=CL28; Flags: Precursor gi|279656|pir||R5NT28 ribosomal protein L28 precursor, chloroplast - tobacco gi|189096147|pdb|3BBO|Y Chain Y, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome gi|20016|emb|CAA48211.1| ribosomal protein CL28 [Nicotiana tabacum] Length = 151 Score = 147 bits (370), Expect = 5e-33 Identities = 70/75 (93%), Positives = 73/75 (97%) Frame = +3 Query: 570 RICPFTGKKANKANKVSHSNHKTKKLQFVNLQYKRIWWEAGNRFVKLRLSTKAIKTIEKN 749 RICPFTGKK+N+ANKVSHSNHKTKKLQFVNLQYKRIWWEAG R+VKLRLSTKAIKTIEKN Sbjct: 76 RICPFTGKKSNRANKVSHSNHKTKKLQFVNLQYKRIWWEAGKRYVKLRLSTKAIKTIEKN 135 Query: 750 GLDAVAKKAGIDLRK 794 GLDAVAKKAGIDL K Sbjct: 136 GLDAVAKKAGIDLSK 150 >gb|AEC11026.1| 50S ribosomal protein L28 [Camellia sinensis] Length = 74 Score = 145 bits (367), Expect = 1e-32 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +3 Query: 576 CPFTGKKANKANKVSHSNHKTKKLQFVNLQYKRIWWEAGNRFVKLRLSTKAIKTIEKNGL 755 CPFTGKK+N+ANKVSHSNHKTKKLQFVNLQYKRIWWEAG R+VKLRLSTKAIKTIEKNGL Sbjct: 1 CPFTGKKSNRANKVSHSNHKTKKLQFVNLQYKRIWWEAGKRYVKLRLSTKAIKTIEKNGL 60 Query: 756 DAVAKKAGIDLRK 794 DAVAKKAGIDLRK Sbjct: 61 DAVAKKAGIDLRK 73 >emb|CBI23685.3| unnamed protein product [Vitis vinifera] Length = 118 Score = 145 bits (367), Expect = 1e-32 Identities = 69/75 (92%), Positives = 73/75 (97%) Frame = +3 Query: 570 RICPFTGKKANKANKVSHSNHKTKKLQFVNLQYKRIWWEAGNRFVKLRLSTKAIKTIEKN 749 R+CPFTGKKANKANKVS SNHKTKKLQFVNLQYK+IWWEAG R+VKLRLSTKA+KTIEKN Sbjct: 43 RVCPFTGKKANKANKVSFSNHKTKKLQFVNLQYKKIWWEAGKRYVKLRLSTKALKTIEKN 102 Query: 750 GLDAVAKKAGIDLRK 794 GLDAVAKKAGIDLRK Sbjct: 103 GLDAVAKKAGIDLRK 117