BLASTX nr result
ID: Cnidium21_contig00000050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00000050 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW63130.1| 31 kDa putative protein [Strawberry latent ringsp... 56 3e-06 >gb|AAW63130.1| 31 kDa putative protein [Strawberry latent ringspot virus satellite RNA] Length = 287 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = -3 Query: 307 SCFGSKMFQETLYKEAVKKVCKLTDAVPVSIPEFMGRLGQVDFGAAPAHVY 155 SCFG KMF +LY AV+KV +L + PV+IPE RLGQVD A H++ Sbjct: 236 SCFGVKMFSSSLYGMAVRKVLRLREDFPVAIPENFARLGQVDRDARAVHLF 286